Looking for study notes for BS Biotechnology at Jinnah University for Women, Karachi? Get valuable insights and tips to excel in your academic journey.BS degree in Biotechnology at Jinnah University for Women is a rewarding experience that can open doors to a wide range of career opportunities in the field of biotechnology. By following our study notes and tips, you can enhance your academic performance and excel in your studies. Good luck on your academic journey

Study Notes BS Biotechnology At Jinnah University for Women, Karachi.

Study Notes: BTH-1022 Biochemistry I & II

Part I: BTH-1022 Biochemistry I (Foundations & Theory)

1. Introduction to Biochemistry

Biochemistry is the study of the chemical processes within and relating to living organisms. It bridges chemistry and biology, focusing on the structure and function of cellular components.

Core Concepts:
- The Cell: The basic unit of life (Prokaryotic vs. Eukaryotic).
- Biomolecules: The four major classes (Carbohydrates, Lipids, Proteins, Nucleic Acids).
- Central Dogma: The flow of genetic information (DNA $\to$ RNA $\to$ Protein).

2. Structure and Function of Biomolecules

2.1 Amino Acids and Proteins

Amino Acids: 20 standard amino acids. General structure: $H_{2} N - C H R - COO H$ .
Peptide Bond: Covalent bond linking amino acids to form polypeptides.
Protein Structure Levels:
- Primary: Linear sequence of amino acids.
- Secondary: Local folding into $α$ -helices and $β$ -pleated sheets (stabilized by H-bonds).
- Tertiary: 3D folding of a single polypeptide (hydrophobic interactions, disulfide bridges).
- Quaternary: Assembly of multiple polypeptide subunits (e.g., Hemoglobin).

2.2 Enzymes: Biological Catalysts

Function: Lower activation energy ( $E_{a}$ ) of reactions without being consumed.
Active Site: The specific region where the substrate binds (Lock and Key vs. Induced Fit models).
Kinetics:
- Michaelis-Menten Equation: $V_{0} = K ^{m} + [ S ] V ^{ma x} [ S ]$
- $K_{m}$ : Substrate concentration at half $V_{ma x}$ ; measure of enzyme affinity.
- $V_{ma x}$ : Maximum reaction rate.
Inhibition:
- Competitive: Inhibitor binds active site; increases $K_{m}$ ; $V_{ma x}$ unchanged.
- Non-competitive: Inhibitor binds elsewhere; $K_{m}$ unchanged; decreases $V_{ma x}$ .

2.3 Nucleic Acids

DNA: Double helix; stores genetic info (A-T, G-C base pairing).
RNA: Single-stranded; involved in protein synthesis (mRNA, tRNA, rRNA).

Part II: BTH-1022 Biochemistry II (Metabolism & Lab Techniques)

This section focuses on the chemical reactions that sustain life (Metabolism) and the practical skills required to study them.

3. Metabolic Overview & Central Pathways

Metabolism is the sum of all chemical reactions. It is divided into Catabolism (breakdown, releases energy) and Anabolism (synthesis, requires energy).

ATP: The universal energy currency of the cell.
Glycolysis (Glucose $\to$ Pyruvate):
- Location: Cytoplasm.
- Aerobic vs. Anaerobic fate of Pyruvate.
The Citric Acid Cycle (Krebs Cycle):
- Location: Mitochondrial matrix.
- Oxidizes Acetyl-CoA to $C O_{2}$ ; generates $N A DH$ , $F A D H_{2}$ , and $GTP$ .
Electron Transport Chain (ETC) & Oxidative Phosphorylation:
- Location: Inner mitochondrial membrane.
- $N A DH$ and $F A D H_{2}$ donate electrons; $O_{2}$ is the final acceptor.
- Chemiosmosis: Proton gradient drives ATP Synthase to produce the bulk of ATP.
Gluconeogenesis: Synthesis of glucose from non-carbohydrate precursors (e.g., lactate, amino acids).
Glycogen Metabolism: Storage and mobilization of glucose.

4. Specialized Metabolism

Lipid Metabolism:
- $β$ -Oxidation: Breakdown of fatty acids into Acetyl-CoA.
- Ketogenesis: Production of ketone bodies during starvation.
Nitrogen Metabolism:
- Transamination and deamination of amino acids.
- Urea Cycle: Disposal of toxic ammonia in the liver.

5. Advanced Lab Techniques (Biochemistry II)

Based on practical syllabi from institutions like ShanghaiTech University, Biochemistry II often emphasizes hands-on skills:

Enzymology:
- Determination of $K_{m}$ and $V_{ma x}$ (using Lineweaver-Burk plots).
- Studying effects of pH, temperature, and inhibitors on enzyme activity.
Chromatography:
- Affinity Chromatography: Purification of His-tagged proteins (using specific binding to separate target proteins from crude extracts).
Protein Analysis:
- SDS-PAGE: Polyacrylamide gel electrophoresis to separate proteins by molecular weight.
Metabolite Extraction & Assays:
- Isolation of glycogen, lecithin, and vitamins (e.g., Vitamin C).
- Colorimetric assays for total sugar or protein quantification.

Key Terminology Checklist

Catabolism: Breakdown of molecules to release energy.
Anabolism: Synthesis of complex molecules from simpler ones.
$K_{m}$ (Michaelis constant): Substrate concentration at half the maximum reaction velocity.
Coupled Reactions: Using an exergonic reaction to drive an endergonic reaction.
Prosthetic Group: A non-protein molecule tightly bound to an enzyme (e.g., heme in catalase).

Self-Test Questions

Part I: Describe the four levels of protein structure. Which bonds stabilize the tertiary structure?
Part II: If you purified a protein using His-tag affinity chromatography, how would you verify its purity and molecular weight?
Integration: Why would a cell switch from glycolysis to gluconeogenesis? What are the key “irreversible” steps that are bypassed?

Cell Biology (BTH-1011) – Comprehensive Study Notes

Course Overview

Attribute	Details
Course Code	BTH-1011
Course Title	Cell Biology
Focus	Structure and function of cellular components, cell membrane transport, cytoskeleton, cell signaling, cell cycle, and cell death
Prerequisites	Basic biology and chemistry

Course Rationale: Cell biology is the foundation of all biological sciences. The cell is the basic structural and functional unit of all living organisms. Understanding how cells work—how they obtain energy, communicate, divide, and die—is essential for comprehending physiology, development, immunology, neurobiology, and disease processes such as cancer.

PART 1: Introduction to Cell Biology

1.1 What is Cell Biology?

Cell Biology is the study of cell structure and function, encompassing the physiological properties, metabolic processes, signaling pathways, life cycle, and interactions of cells with their environment.

Cell Theory (Schleiden, Schwann, Virchow, 1838-1855):

Tenet	Statement
1	All living organisms are composed of one or more cells
2	The cell is the basic structural and functional unit of life
3	All cells arise from pre-existing cells (omnis cellula e cellula)

1.2 Cell Types: Prokaryotes vs. Eukaryotes

Feature	Prokaryotic Cells	Eukaryotic Cells
Nucleus	Absent (nucleoid region – no nuclear membrane)	Present (membrane-bound nucleus)
Membrane-bound organelles	Absent	Present (mitochondria, ER, Golgi, lysosomes, peroxisomes, etc.)
Size	0.5–5 μm	10–100 μm
Ribosomes	70S (50S + 30S subunits)	80S (60S + 40S subunits)
Cell division	Binary fission	Mitosis (somatic cells), Meiosis (germ cells)
Cell wall	Present (peptidoglycan in bacteria; pseudopeptidoglycan or other polymers in archaea)	Present in plants (cellulose), fungi (chitin), absent in animals
Flagella structure	Flagellin protein; rotating motor (proton motive force)	Microtubules (9+2 arrangement); ATP-driven (dynein)
Genetic recombination	Conjugation, transformation, transduction (parasexual)	Meiosis and fertilization (sexual reproduction)
Examples	Bacteria, Archaea	Protists, fungi, plants, animals

1.3 Cell Size and Shape Limitations

Why cells are small: The surface area-to-volume ratio (SA:V) limits cell size.

As cell size increases, volume increases faster than surface area
SA:V ratio decreases → insufficient membrane area for nutrient exchange and waste removal
Formula for sphere: SA = 4πr²; V = (4/3)πr³; SA:V = 3/r

Cell shapes:

Shape	Function	Example
Spherical	Suspended in fluid	Red blood cells (mammalian), white blood cells
Cuboidal	Lining ducts, glands	Epithelial cells (kidney tubules, salivary glands)
Columnar	Absorption, secretion	Intestinal epithelial cells
Squamous (flattened)	Diffusion, lining blood vessels	Endothelial cells, lung alveoli epithelial cells
Fusiform (spindle)	Contraction	Smooth muscle cells
Stellate (star-shaped)	Communication	Neurons, astrocytes
Polygonal	Variable shape	Hepatocytes (liver cells)

PART 2: Cell Membrane Structure and Transport

2.1 Fluid Mosaic Model (Singer & Nicolson, 1972)

The cell membrane is a dynamic, fluid structure composed of a phospholipid bilayer with embedded and associated proteins.

Membrane Components:

Component	Structure	Function
Phospholipids	Hydrophilic head (phosphate + charged group) + hydrophobic tails (fatty acids)	Form bilayer barrier; regulates fluidity
Cholesterol	Sterol ring structure (only in animal cells; plants have phytosterols, fungi have ergosterol)	Modulates membrane fluidity; prevents crystallization; stabilizes membrane
Glycolipids	Lipid + carbohydrate chain (oligosaccharide)	Cell recognition; immune function (ABO blood group antigens)
Integral membrane proteins	Transmembrane domains (α-helical or β-barrel)	Transport (channels, carriers, pumps), signaling (receptors), adhesion
Peripheral membrane proteins	Associated with membrane surface (non-covalent interactions)	Enzymatic activity; cytoskeletal anchoring; signaling

Membrane Asymmetry:

Leaflet	Enriched in
Outer (extracellular) leaflet	Phosphatidylcholine, sphingomyelin, glycolipids
Inner (cytoplasmic) leaflet	Phosphatidylethanolamine, phosphatidylserine (negatively charged), phosphatidylinositol

Flippases, floppases, scramblases: Enzymes that maintain asymmetry by translocating lipids between leaflets.

2.2 Membrane Transport Mechanisms

Transport Type	Energy	Carrier/Channel	Direction	Example
Simple diffusion	None (passive)	No (through lipid bilayer)	Down concentration gradient	O₂, CO₂, steroid hormones, ethanol
Facilitated diffusion (channel)	None (passive)	Yes (channel protein)	Down concentration gradient	Ion channels (Na⁺, K⁺, Ca²⁺, Cl⁻), aquaporins (water)
Facilitated diffusion (carrier)	None (passive)	Yes (carrier protein)	Down concentration gradient	GLUT1 (glucose transporter), urea transporter
Primary active transport	ATP (direct)	Yes (pump)	Against concentration gradient	Na⁺/K⁺ ATPase, Ca²⁺ ATPase, H⁺/K⁺ ATPase
Secondary active transport (symport)	Ion gradient (indirect)	Yes (cotransporter)	One solute down gradient, one against	SGLT1 (Na⁺/glucose symport), Na⁺/amino acid symport
Secondary active transport (antiport)	Ion gradient (indirect)	Yes (exchanger)	One solute down gradient, one against	Na⁺/H⁺ exchanger (NHE), Na⁺/Ca²⁺ exchanger (NCX), Cl⁻/HCO₃⁻ exchanger

Na⁺/K⁺ ATPase (Sodium-Potassium Pump):

Pumps 3 Na⁺ out, 2 K⁺ in per ATP hydrolyzed
Maintains electrochemical gradient: intracellular Na⁺ low (~10-15 mM), extracellular Na⁺ high (~145 mM); intracellular K⁺ high (~140 mM), extracellular K⁺ low (~4 mM)
Generates negative resting membrane potential (electrogenic)
Accounts for ~20-40% of cellular ATP consumption (up to 70% in neurons)
Inhibited by: Cardiac glycosides (digoxin, ouabain – used for heart failure)

Ion Channels:

Type	Gating mechanism	Location	Function
Voltage-gated	Membrane potential change	Axons, muscle T-tubules, nodes of Ranvier	Action potential propagation (Na⁺, K⁺, Ca²⁺ channels)
Ligand-gated	Neurotransmitter binding (ACh, GABA, glutamate)	Postsynaptic membrane, neuromuscular junction	Synaptic transmission (nicotinic ACh receptor, GABAₐ receptor, AMPA/NMDA receptors)
Mechanosensitive	Mechanical stress (stretch, pressure)	Auditory hair cells, baroreceptors, touch receptors, kidney (osmoregulation)	Hearing (hair cell stereocilia), touch, blood pressure regulation
Leak channels	Always open (constitutively active)	Most cells, especially neurons	Resting membrane potential (K⁺ leak channels)

PART 3: Cell Organelles and Their Functions

3.1 Organelle Overview

Organelle	Size	Structure	Primary Function
Nucleus	5-10 μm	Double membrane (nuclear envelope) + nuclear pores + nucleolus + chromatin	DNA storage; transcription (RNA synthesis); ribosome subunit assembly
Mitochondria	0.5-1 μm (diameter)	Double membrane; inner membrane folded into cristae; matrix	ATP synthesis (oxidative phosphorylation); Ca²⁺ buffering; apoptosis regulation; thermogenesis (UCP1 in brown fat)
Ribosomes	20-30 nm (diameter)	rRNA + protein (large + small subunits)	Protein synthesis (translation)
Rough endoplasmic reticulum (RER)	Sheets with ribosomes	Membrane network with ribosomes attached	Synthesis of secretory, membrane, and lysosomal proteins; initial N-linked glycosylation
Smooth endoplasmic reticulum (SER)	Tubular network	Membrane network without ribosomes	Lipid synthesis; detoxification (cytochrome P450); Ca²⁺ storage; steroid synthesis; carbohydrate metabolism
Golgi apparatus	0.5-1 μm (stack)	Stacked cisternae (3-8)	Post-translational modification (O-linked glycosylation, phosphorylation, sulfation, proteolytic processing); protein sorting; vesicle packaging
Lysosomes	0.1-1.2 μm	Single membrane; lumen pH ~5 (acidic)	Intracellular digestion (hydrolysis of macromolecules via hydrolases); autophagy; phagocytosis breakdown
Peroxisomes	0.1-1 μm	Single membrane	β-Oxidation of very long chain fatty acids (>C22); H₂O₂ metabolism (catalase); plasmalogen synthesis; bile acid synthesis
Proteasomes	15-20 nm (barrel)	26S complex (20S core + 19S regulatory particles)	Degradation of ubiquitin-tagged proteins (protein quality control, cell cycle regulation, antigen processing)

3.2 Nucleus

Nuclear envelope: Double membrane (outer membrane continuous with RER; inner membrane has nuclear lamina). Perinuclear space (lumen) between membranes (20-40 nm).

Nuclear pores: Nuclear pore complexes (NPCs) regulate transport between nucleus and cytoplasm. 8-fold symmetry; size: ~100 nm diameter; molecular weight: ~125 MDa (in vertebrates). Selective permeability: small molecules (<40 kDa) diffuse passively; larger molecules (proteins, RNA) require active transport via nuclear localization signals (NLS) or nuclear export signals (NES).

Nucleolus: Site of ribosome biogenesis (rRNA transcription by RNA polymerase I, rRNA processing, assembly with ribosomal proteins). Nucleolus organizer regions (NORs) contain rRNA genes (rDNA).

Chromatin: DNA + histones (H2A, H2B, H3, H4 – core histones; H1 – linker histone) + non-histone proteins.

3.3 Mitochondria

Structure:

Outer mitochondrial membrane (OMM): Permeable to small molecules (porins); contains proteins involved in apoptosis (Bcl-2 family, VDAC)
Intermembrane space (IMS): Similar composition to cytosol; contains pro-apoptotic factors (cytochrome c, Smac/Diablo, HtrA2/Omi, AIF – apoptosis-inducing factor)
Inner mitochondrial membrane (IMM): Highly impermeable; contains electron transport chain complexes (I-IV) and ATP synthase (complex V); highly folded into cristae
Matrix: Contains mitochondrial DNA (mtDNA; circular, ~16.6 kbp in humans; 2-10 copies per mitochondrion), mitochondrial ribosomes (70S), TCA cycle enzymes, fatty acid oxidation enzymes

Functions:

Function	Description
ATP synthesis	Oxidative phosphorylation (ETC + ATP synthase) – produces >90% of cellular ATP
Apoptosis regulation	Releases cytochrome c and other pro-apoptotic factors from IMS into cytosol → activates caspases (intrinsic/mitochondrial pathway of apoptosis)
Ca²⁺ buffering	Takes up Ca²⁺ from cytosol via MCU (mitochondrial calcium uniporter); regulates cytosolic Ca²⁺ signaling
Thermogenesis	Uncoupling protein 1 (UCP1) in brown adipose tissue; generates heat (non-shivering thermogenesis); dissipates proton gradient without ATP synthesis
Heme synthesis	First and last steps (aminolevulinic acid synthase – ALAS; ferrochelatase)
Steroid synthesis	Rate-limiting step (conversion of cholesterol to pregnenolone) in steroidogenic tissues (adrenal cortex, gonads)

Mitochondrial dynamics:

Fission: Division of mitochondria (regulated by Drp1, Fis1)
Fusion: Merging of mitochondria (regulated by Mfn1, Mfn2 – OMM; Opa1 – IMM)
Mitophagy: Autophagic removal of damaged mitochondria (PINK1/Parkin pathway)

3.4 Endomembrane System

Components: ER, Golgi, lysosomes, endosomes, secretory vesicles, plasma membrane (connected by vesicular transport).

Rough Endoplasmic Reticulum (RER):

Ribosomes bound to membrane (via translocon – Sec61 complex)
Function: Synthesis of secretory proteins, membrane proteins, and lysosomal proteins
Co-translational translocation: Protein synthesized into ER lumen
N-linked glycosylation: Addition of oligosaccharide to asparagine (Asn-X-Ser/Thr sequon)
Protein folding: Chaperones (BiP, calnexin, calreticulin); disulfide bond formation (PDI – protein disulfide isomerase)
Quality control: ERAD (ER-associated degradation) removes misfolded proteins

Smooth Endoplasmic Reticulum (SER):

No ribosomes; tubular network
Functions:
- Lipid synthesis: Phospholipids, cholesterol, steroids (adrenal cortex, gonads)
- Detoxification: Cytochrome P450 monooxygenase system (liver, kidney) – oxidizes drugs, toxins, xenobiotics (Phase I metabolism)
- Ca²⁺ storage: In muscle (sarcoplasmic reticulum – specialized SER); Ca²⁺ release via ryanodine receptors (RyR) and IP₃ receptors
- Carbohydrate metabolism: Glucose-6-phosphatase (G6Pase) in liver; final step of gluconeogenesis and glycogenolysis

Golgi Apparatus:

Region	Function
cis-Golgi (entry, nearest ER)	Receives vesicles from ER; phosphorylation of lysosomal proteins (mannose-6-phosphate tagging)
medial-Golgi	Modification of N-linked glycans; addition of O-linked glycans (to Ser/Thr)
trans-Golgi (exit)	Sorting and packaging into vesicles (clathrin-coated vesicles for lysosomes; secretory vesicles for constitutive or regulated secretion)

Protein sorting signals:

Destination	Signal	Example
ER lumen	N-terminal signal peptide (hydrophobic, 6-15 residues)	Secretory proteins
ER membrane	Transmembrane domain (stop-transfer signal)	Integral membrane proteins
Golgi	No specific signal; default pathway from ER	Many proteins
Lysosome (via M6P receptor)	Mannose-6-phosphate (added in cis-Golgi)	Hydrolases
Nucleus	Nuclear localization signal (NLS) – basic residues (KKRK)	Histones, transcription factors
Mitochondria	N-terminal mitochondrial targeting signal (amphipathic helix)	Matrix proteins
Peroxisome	C-terminal SKL (Ser-Lys-Leu) or similar PTS1/PTS2	Peroxisomal matrix proteins
Plasma membrane (apical in epithelia)	Glycosylphosphatidylinositol (GPI) anchor	Alkaline phosphatase, Thy-1, many membrane proteins

PART 4: Cytoskeleton

4.1 Overview of Cytoskeletal Elements

Feature	Microfilaments	Intermediate Filaments	Microtubules
Diameter	7 nm	10 nm	25 nm
Subunit	G-actin (globular) polymerizes to F-actin (filamentous)	Various (keratins, vimentin, desmin, lamins, neurofilaments, GFAP)	α-tubulin + β-tubulin heterodimers
Structure	Double helix	Coiled-coil tetramers → protofilaments (8-12) → filament	13 protofilaments forming hollow cylinder
Polarity	Yes (plus end (barbed); minus end (pointed))	No (non-polar)	Yes (plus end (β-tubulin exposed); minus end (α-tubulin exposed))
Dynamic instability	Yes (treadmilling; severing by cofilin)	No (stable)	Yes (catastrophe (rapid depolymerization) and rescue (growth) at plus end)
Nucleation	Actin-related proteins (Arp2/3 complex); formins	Assembly from dimers	γ-tubulin ring complex (γ-TuRC) at centrosome
Motor proteins	Myosin (I, II, V, VI, X, etc.) – toward plus end (myosin V) or minus end (myosin VI)	None	Kinesin (plus end-directed); Dynein (minus end-directed)
Drugs	Cytochalasin (cap plus end, prevent polymerization); Phalloidin (stabilize F-actin); Latrunculin (sequester G-actin)	–	Taxol (paclitaxel) stabilizes; Colchicine, vinca alkaloids (vincristine, vinblastine) depolymerize; Nocodazole depolymerizes

4.2 Microfilaments (Actin)

Functions:

Cell shape and support (cortex beneath plasma membrane)
Muscle contraction (thin filaments in sarcomeres; with myosin II)
Cell motility (lamellipodia, filopodia, invadopodia)
Cytokinesis (contractile ring)
Cell-cell junctions (adherens junctions: actin-E-cadherin-β-catenin-α-actinin-connectin)
Cell-matrix adhesions (focal adhesions: actin-integrin-talin-vinculin-paxillin)
Vesicle/organelle transport (myosin motors)

Actin-binding proteins:

Protein	Function
Profilin	Promotes actin polymerization (binds G-actin, enhances nucleotide exchange; delivers to plus end)
Cofilin (ADF – actin depolymerizing factor)	Severs F-actin; increases depolymerization
Thymosin β4	Sequesters G-actin (prevents polymerization)
Arp2/3 complex	Nucleates branched actin filaments (for lamellipodia)
Formins	Nucleates linear actin filaments (for stress fibers, contractile ring, filopodia)
α-Actinin	Crosslinks actin filaments (antiparallel, in stress fibers, Z-discs)
Fimbrin	Crosslinks actin filaments (parallel, in microvilli)
Filamin	Crosslinks actin filaments at wide angles (gel-like networks)
Tropomyosin	Stabilizes F-actin; regulates myosin binding
Troponin	Regulates muscle contraction (Ca²⁺-dependent)

4.3 Microtubules

Functions:

Cell shape and support (axons, cilia, flagella)
Intracellular transport (vesicles, organelles, mRNA, protein complexes) via kinesin and dynein motors
Mitotic spindle (chromosome segregation)
Cilia and flagella (axoneme structure: 9+2 arrangement; motile: dynein arms; primary cilia: sensory)

Microtubule-associated proteins (MAPs):

MAP	Function
Tau (MAPT)	Stabilizes axonal microtubules; hyperphosphorylated in Alzheimer’s disease (neurofibrillary tangles)
MAP2	Dendrite-specific microtubule stabilization; regulates microtubule dynamics
EB1	Binds growing plus ends; tracks polymerization
Katanin	Severs microtubules (ATP-dependent)
Spastin	Severs microtubules (mutations cause hereditary spastic paraplegia)

Motor proteins:

Motor	Direction	Cargo	Location
Kinesin-1 (conventional kinesin)	Plus end	Vesicles, organelles, mRNA, protein complexes	All cells; axonal transport (anterograde)
Kinesin-13	Plus end (depolymerizes)	Regulates microtubule dynamics	Mitotic spindle
Dynein	Minus end	Vesicles, organelles, mRNA, protein complexes; ciliary/flagellar beating	All cells; axonal transport (retrograde)

4.4 Intermediate Filaments

Types and tissue distribution:

Type	Protein(s)	Cell/Tissue
I	Acidic keratins (K9-K20)	Epithelial cells (specific to epithelium type)
II	Basic/neutral keratins (K1-K8)	Epithelial cells (pair with type I keratins)
III	Vimentin	Mesenchymal cells (fibroblasts, endothelial cells, leukocytes)
	Desmin	Muscle cells (surround Z-discs)
	GFAP (glial fibrillary acidic protein)	Astrocytes, glial cells
	Peripherin	Peripheral neurons
IV	Neurofilaments (NF-L, NF-M, NF-H)	Neurons (axons)
	α-Internexin	Developing neurons
V	Lamins A, B, C	Nuclear lamina (inner nuclear membrane)
VI	Nestin	Neuroprogenitor cells (developing CNS)

Functions:

Mechanical strength (resist tension, shear stress)
Maintain cell shape and integrity
Nuclear structure and organization (lamins)
Anchoring desmosomes and hemidesmosomes (keratins)

Diseases of intermediate filaments:

Protein	Disease
Keratins (K5/K14)	Epidermolysis bullosa simplex (skin blistering)
Keratins (K8/K18)	Cryptogenic cirrhosis (liver)
Desmin	Desmin-related myopathy (cardiomyopathy, skeletal muscle weakness)
GFAP	Alexander disease (leukodystrophy, macrocephaly)
Neurofilaments	Amyotrophic lateral sclerosis (ALS), Charcot-Marie-Tooth disease
Lamins	Progeria (Hutchinson-Gilford progeria syndrome, lamin A mutation), Emery-Dreifuss muscular dystrophy, lipodystrophy, dilated cardiomyopathy

PART 5: Cell Signaling

5.1 Overview of Cell Communication

Type	Distance	Speed	Examples
Autocrine	Same cell	Short	Immune cells (interleukins, cytokines); cancer cells (self-stimulation)
Paracrine	Nearby cells	Short	Neurotransmitters (synaptic clefts), histamine, growth factors
Endocrine	Distant (via bloodstream)	Slower (seconds to minutes to hours)	Hormones (insulin, thyroid hormone, estrogen, testosterone)
Juxtacrine	Direct contact	Immediate	Notch signaling (cell-cell contact), cadherins, integrins
Synaptic	Across synapse (20-50 nm)	Rapid (milliseconds)	Neurotransmission (ACh, glutamate, GABA, dopamine, serotonin, norepinephrine)

5.2 Major Signaling Pathways

G Protein-Coupled Receptors (GPCRs):

Largest receptor family (800+ members in humans)
7 transmembrane domains (heptahelical)
Ligands: hormones (epinephrine, glucagon), neurotransmitters (dopamine, serotonin), odorants, tastants, light (rhodopsin), chemokines, opioids
G proteins: Heterotrimeric (Gα, Gβ, Gγ) – Gα binds GDP/GTP; Gβγ dimer dissociates upon activation
Major G protein classes:
| Class | Gα subunit | Effector | Second Messenger | Examples |
|——-|———–|———-|——————|———-|
| Gs | Gαs | Adenylyl cyclase ↑ | cAMP ↑ | β-Adrenergic receptors (epinephrine), glucagon receptor |
| Gi | Gαi | Adenylyl cyclase ↓; K⁺ channels ↑ | cAMP ↓ | α₂-Adrenergic receptors, dopamine D₂ receptor, adenosine A₁ receptor |
| Gq | Gαq | Phospholipase C β (PLCβ) | IP₃, DAG, Ca²⁺ ↑ | α₁-Adrenergic receptors, histamine H₁ receptor, vasopressin V₁ receptor, angiotensin II AT₁ receptor |
| G₁₂/₁₃ | Gα₁₂/₁₃ | RhoGEF (Rho guanine nucleotide exchange factor) → Rho activation | Cytoskeleton changes | Thrombin receptor, lysophosphatidic acid (LPA) receptor |

Receptor Tyrosine Kinases (RTKs):

Structure: Extracellular ligand-binding domain + single transmembrane helix + intracellular tyrosine kinase domain
Ligands: growth factors (EGF, PDGF, insulin, NGF, FGF, VEGF, HGF)
Activation: Ligand binding induces dimerization → autophosphorylation of tyrosine residues → docking sites for adaptor proteins (Grb2, Shc, IRS-1/2, STATs, PLCγ)
Downstream pathways:
- Ras-MAPK pathway: Grb2 → SOS (GEF) → Ras (GTP-bound) → Raf (MAPKKK) → MEK (MAPKK) → ERK (MAPK) → transcription factors (Elk1, c-Fos, c-Jun) → cell proliferation, differentiation, survival
- PI3K-Akt pathway: PI3K (phosphoinositide 3-kinase) → PIP₃ → PDK1 → Akt (PKB) → mTOR, BAD, GSK3, FoxO → cell survival, growth, metabolism
- PLCγ pathway: PLCγ → IP₃ + DAG → Ca²⁺ release + PKC activation

Intracellular (Steroid) Receptors:

Location: Cytoplasm or nucleus (unliganded)
Ligands: steroid hormones (estrogen, progesterone, testosterone, cortisol, aldosterone), thyroid hormone (T3/T4), vitamin D, retinoic acid
Mechanism: ligand binds → receptor conformational change → translocation to nucleus (if cytoplasmic) → dimerization → DNA binding (hormone response elements – HREs) → gene transcription regulation (co-activators or co-repressors recruited)
Nuclear receptor superfamily: 48 members in humans (includes orphan receptors with unknown ligands; some constitutive activity)

PART 6: Cell Cycle

6.1 Phases of the Cell Cycle

The cell cycle is divided into interphase (preparation for division) and mitosis (division).

Phase	Duration (typical mammalian cell)	Key Events
G₁ (Gap 1)	8-12 hours	Cell growth, protein synthesis (ribosomes, tRNA, enzymes), preparation for DNA synthesis; restriction point (commitment to divide)
S (Synthesis)	6-8 hours	DNA replication (chromosome duplication); histones synthesized; sister chromatids formed
G₂ (Gap 2)	4-6 hours	Preparation for mitosis; microtubule synthesis; centrosome maturation; DNA damage and completeness check
M (Mitosis)	1-2 hours	Nuclear division (mitosis) + cytoplasmic division (cytokinesis)

Cells that exit cell cycle: Enter G₀ (quiescent, non-dividing) – terminally differentiated cells (neurons, skeletal muscle cells, cardiomyocytes) or quiescent cells that can re-enter cell cycle upon stimulation (hepatocytes, lymphocytes, fibroblasts).

6.2 Checkpoints and Regulation

Checkpoint	Location	Function	Key players	Defect consequences
G₁/S (Start, restriction point in mammals)	Late G₁	Checks: cell size, nutrients, growth factors, DNA damage	p53, p21, Rb, cyclin D-CDK4/6, cyclin E-CDK2	Uncontrolled entry into S phase; cancer
G₂/M	G₂/M transition	Checks: DNA replication completion (no unreplicated DNA); DNA damage; cell size	p53, p21, cyclin B-CDK1 (mitosis promoting factor – MPF)	Premature mitosis with damaged/unreplicated DNA
Spindle (M)	Metaphase (before anaphase)	Checks: all chromosomes attached to spindle (kinetochores attached to microtubules)	Mad2, BubR1, Cdc20, APC/C	Anaphase with unattached chromosomes → aneuploidy (Down syndrome, cancer)

Cyclin-dependent kinases (CDKs) and cyclins:

Cyclin	CDK partner	Phase	Function
Cyclin D	CDK4, CDK6	G₁ (early)	G₁ progression; phosphorylates Rb
Cyclin E	CDK2	G₁/S (late)	G₁/S transition; initiates DNA replication
Cyclin A	CDK2 (S); CDK1 (G₂)	S, G₂	S phase progression; DNA replication
Cyclin B	CDK1	G₂, M (G₂/M transition, mitosis)	Entry into mitosis (MPF activity)

Key regulators:

p53 (tumor suppressor, “guardian of the genome”): Activated by DNA damage, hypoxia, oncogene activation → induces p21 → inhibits CDKs → arrests cell cycle → allows DNA repair; if repair fails → induces apoptosis (transcription of pro-apoptotic genes: Bax, Puma, Noxa) → eliminates damaged cells
Retinoblastoma protein (Rb, tumor suppressor): Hypophosphorylated Rb binds E2F (transcription factor) → blocks S phase entry. Hyperphosphorylated by cyclin D-CDK4/6 and cyclin E-CDK2 → releases E2F → activates S phase genes
p21 (CDK inhibitor, CIP1): Induced by p53; inhibits cyclin-CDK complexes (broad specificity)
p16 (INK4a): Specific inhibitor of CDK4/6 (cyclin D); mutated in many cancers (familial melanoma, pancreatic cancer)

6.3 Mitosis (M Phase)

Phase	Key Events
Prophase	Chromosomes condense (visible under light microscope); centrosomes migrate to opposite poles; mitotic spindle forms (astral microtubules, kinetochore microtubules, polar (interpolar) microtubules); nucleolus disappears; nuclear envelope begins to fragment
Prometaphase	Nuclear envelope disassembles (phosphorylation of lamins by CDK1); kinetochore microtubules attach to kinetochores (protein complex on centromeres); chromosomes begin moving
Metaphase	Chromosomes align at metaphase plate (equatorial plate); spindle checkpoint (Mad2/BubR1) ensures all kinetochores attached to microtubules
Anaphase	Anaphase A: Sister chromatids separate (cohesin cleaved by separase); pulled to opposite poles (kinetochore microtubules shorten). Anaphase B: Poles move apart (polar microtubules lengthen)
Telophase	Chromosomes decondense; nuclear envelope reforms around each set of chromosomes; nucleoli reappear; mitotic spindle disassembles
Cytokinesis	Cleavage furrow (actin-myosin contractile ring) pinches cell into two; in plants: cell plate forms (vesicles from Golgi fuse at metaphase plate)

6.4 Apoptosis (Programmed Cell Death)

Feature	Apoptosis	Necrosis (unprogrammed)
Induction	Physiological (development, immune regulation, homeostasis) or pathological (DNA damage)	Pathological (trauma, infection, ischemia, toxins)
Morphology	Cell shrinkage; chromatin condensation; nuclear fragmentation; membrane blebbing; apoptotic bodies	Cell swelling; organelle swelling; membrane rupture
Biochemistry	Caspase activation; DNA fragmentation (laddering on gel, 180-200 bp fragments); phosphatidylserine externalization (phagocyte recognition via annexin V); mitochondrial outer membrane permeabilization (MOMP)	Loss of ATP; release of cellular contents (inflammatory)
Inflammation	No (apoptotic bodies phagocytosed by macrophages without releasing cellular contents)	Yes (inflammation triggered by released cellular contents)

Apoptosis pathways:

Pathway	Trigger	Mechanism
Intrinsic (mitochondrial)	DNA damage, oxidative stress, growth factor withdrawal, ER stress	p53 activation (DNA damage) → Bax/Bak oligomerization → MOMP → cytochrome c release → Apaf-1 activation → caspase-9 activation → caspase-3 activation → apoptosis
Extrinsic (death receptor)	Extracellular signals (Fas ligand, TNF-α, TRAIL)	Death receptor (Fas, TNFR1, DR4/5) trimerization → DISC (FADD, procaspase-8) → caspase-8 activation → caspase-3 activation → apoptosis; Type I cells (caspase-8 directly activates executioner caspases); Type II cells (caspase-8 cleaves Bid → tBid → MOMP → amplifies via mitochondria)
Perforin/granzyme	Cytotoxic T lymphocytes (CTL), NK cells	Perforin forms pores; granzyme B enters target cell → cleaves caspase-3 directly or activates caspase-9 via Bid

Summary Tables

Comparison of Cell Types

Feature	Prokaryote	Eukaryote
Nucleus	No	Yes
Membrane-bound organelles	No	Yes
Size	0.5-5 μm	10-100 μm
Ribosomes	70S	80S
Cell wall (if present)	Peptidoglycan (bacteria); pseudopeptidoglycan (archaea)	Cellulose (plants), chitin (fungi); none (animals)
Cell division	Binary fission	Mitosis, meiosis
Example	E. coli, Bacillus, Sulfolobus	Saccharomyces (yeast), Arabidopsis (plant), Mus musculus (mouse), Homo sapiens (human)

Organelle Functions Quick Reference

Organelle	Primary Function	Key Feature
Nucleus	DNA storage; transcription	Nuclear pores; nuclear lamina
Mitochondria	ATP

BTH-2072: MOLECULAR BIOLOGY – Complete Study Notes

This comprehensive guide covers the molecular basis of biological processes, including DNA replication, transcription, translation, gene regulation, and molecular biology techniques. These notes are designed for undergraduate and graduate students of biotechnology, molecular biology, and genetics.

PART 1: INTRODUCTION TO MOLECULAR BIOLOGY

1.1 Definition and Scope

Definition: Molecular biology is the branch of biology that studies the structure, function, and interactions of macromolecules (nucleic acids and proteins) essential for life. It focuses on understanding how genetic information is stored, replicated, expressed, and regulated.

The Central Dogma of Molecular Biology (Francis Crick, 1958):

$DNA replication DNA transcription RNA translation Protein$

Exceptions to the Central Dogma:

Exception	Description	Example
Reverse transcription	RNA → DNA	Retroviruses (HIV), telomerase
RNA replication	RNA → RNA	RNA viruses (poliovirus, influenza)
RNA editing	Post-transcriptional alteration of RNA sequence	Apolipoprotein B (C→U deamination); guide RNA insertion/deletion (trypanosomes)
Direct DNA→protein (theoretical)	Not found in nature	—
Prions	Protein → Protein (conformational change)	Prion diseases (CJD, mad cow)

1.2 Key Macromolecules

Molecule	Building Blocks	Functions
DNA (Deoxyribonucleic acid)	Deoxyribonucleotides (A, G, C, T)	Long-term genetic information storage
RNA (Ribonucleic acid)	Ribonucleotides (A, G, C, U)	Information transfer (mRNA), catalysis (rRNA, ribozymes), translation (tRNA), regulation (miRNA, siRNA, lncRNA)
Proteins	Amino acids (20 standard)	Enzymes, structural components, signaling, transport, immunity

PART 2: DNA STRUCTURE AND PROPERTIES

2.1 Chemical Structure of DNA

Nucleotide Components:

Component	DNA	RNA
Nitrogenous base	A, G, C, T	A, G, C, U
Pentose sugar	2′-deoxy-D-ribose (H at 2′)	D-ribose (OH at 2′)
Phosphate group	H₃PO₄ (connects sugars via 3′ and 5′ carbons)	Same

Nucleotide Nomenclature:

Base	Nucleoside (sugar + base)	Nucleotide (nucleoside + phosphate)
Adenine	Deoxyadenosine	dAMP, dADP, dATP
Guanine	Deoxyguanosine	dGMP, dGDP, dGTP
Cytosine	Deoxycytidine	dCMP, dCDP, dCTP
Thymine	Thymidine	dTMP, dTDP, dTTP

2.2 DNA Double Helix (Watson-Crick Model, 1953)

Feature	Description
Strands	Two antiparallel polynucleotide chains (5’→3′ and 3’→5′)
Sugar-phosphate backbone	Outside, hydrophilic
Bases	Inside, stacked, hydrophobic
Base pairing	A=T (2 hydrogen bonds); G≡C (3 hydrogen bonds)
Diameter	20 Å (2 nm)
Helical repeat	10.5 bp per turn (34 Å per turn)
Major groove	22 Å wide; protein binding site (transcription factors)
Minor groove	12 Å wide; protein binding site

Types of DNA Double Helices:

Type	Helix sense	bp per turn	Conditions	Examples
B-DNA	Right-handed	10.5	Physiological (high humidity, hydrated)	Most cellular DNA
A-DNA	Right-handed	11	Dehydrated, RNA-DNA hybrids	Some protein-DNA complexes
Z-DNA	Left-handed	12	High salt, alternating purine-pyrimidine (CG repeats)	Transcription regulation (some promoters)

2.3 DNA Denaturation and Renaturation

Denaturation (Melting): Separation of double-stranded DNA into single strands by breaking hydrogen bonds.

Denaturing Agent	Mechanism
Heat	Increases molecular motion; breaks H-bonds
Alkali (NaOH)	Deprotonates bases; disrupts H-bonds
Urea, formamide	Competes for H-bonds

Melting Temperature (Tₘ): Temperature at which 50% of DNA is denatured (hyperchromic shift: single-stranded DNA absorbs more UV light at 260 nm than double-stranded DNA).

Factors	Effect on Tₘ
Higher G+C content	Increases Tₘ (G≡C has 3 H-bonds)
Higher salt concentration	Increases Tₘ (shields phosphate charge repulsion)
Longer DNA	Increases Tₘ (longer regions cooperatively melt)

Renaturation (Annealing): Single strands re-form double helix when conditions return to physiological.

Cot Curve (kinetics of renaturation):

$Cot = C_{0} \times t$

Where C₀ = initial concentration, t = time

Cot½ (midpoint)	Genome Complexity
Low	Highly repetitive DNA (satellite DNA)
Medium	Moderately repetitive DNA (rRNA genes, transposons)
High	Unique or low-copy DNA (single-copy genes)

PART 3: DNA REPLICATION

3.1 General Principles

Requirements for DNA Replication:

Template (single-stranded DNA)
Primers (RNA or DNA, with free 3′-OH)
Deoxynucleoside triphosphates (dNTPs: dATP, dGTP, dCTP, dTTP)
DNA polymerase (requires Mg²⁺; adds nucleotides 5’→3′)
Energy (from dNTP hydrolysis)

DNA Replication is Semiconservative: Each daughter DNA molecule consists of one parental strand and one newly synthesized strand (Meselson-Stahl experiment, 1958).

3.2 Prokaryotic DNA Replication (E. coli)

Key Enzymes and Proteins:

Enzyme/Protein	Function
DnaA (initiator protein)	Binds origin (oriC); unwinds AT-rich region
DnaB (helicase)	Unwinds DNA (5’→3′ on lagging strand template)
DnaC (helicase loader)	Assembles helicase onto DNA
Single-stranded binding protein (SSB)	Protects single-stranded DNA; prevents reannealing
Topoisomerase II (DNA gyrase)	Relieves supercoiling (introduces negative supercoils ahead of replication fork)
Primase (DnaG)	Synthesizes RNA primers (10-12 nt)
DNA polymerase III holoenzyme	Main replicative polymerase (5’→3′ synthesis; 3’→5′ proofreading exonuclease)
DNA polymerase I	Removes RNA primers; fills gaps (5’→3′ exonuclease, 5’→3′ polymerase)
DNA ligase	Seals nicks (joins Okazaki fragments; uses NAD⁺ in bacteria, ATP in eukaryotes)

Origin of Replication in E. coli (oriC):

Feature	Description
Length	245 bp
AT-rich region	13-mer repeats (AT-rich; easier strand separation)
DnaA boxes	9-mer repeats (DnaA binding sites)
GATC methylation sites	Dam methylase regulates initiation (hemimethylation prevents reinitiation)

Replication Fork:

Leading strand template (3'→5') ← Leading strand synthesis (continuous, 5'→3')
                              ↗
Replication fork direction →
                              ↘
Lagging strand template (5'→3') ← Lagging strand synthesis (discontinuous, Okazaki fragments)

Okazaki Fragments:

Length: 1000-2000 nt in prokaryotes; 100-200 nt in eukaryotes
RNA primers removed by DNA polymerase I (5’→3′ exonuclease activity)
Gaps filled by DNA polymerase I
Nicks sealed by DNA ligase

3.3 Eukaryotic DNA Replication

Feature	Prokaryotes (E. coli)	Eukaryotes
Origin structure	Single oriC (245 bp)	Many origins (ARS, 50-100 bp each; 10,000-100,000 origins per genome)
Origin recognition	DnaA	ORC (Origin Recognition Complex, 6 subunits)
Helicase	DnaB	MCM (Minichromosome Maintenance, 2-7 complex, 6 subunits)
Primase	DnaG	DNA polymerase α-primase complex (primase + Pol α)
Replicative polymerase (leading)	DNA pol III	DNA polymerase δ (with PCNA)
Replicative polymerase (lagging)	DNA pol III	DNA polymerase ε (leading) + Pol δ (lagging)
Clamp	β-sliding clamp (dimer)	PCNA (Proliferating Cell Nuclear Antigen, trimer)
Clamp loader	γ complex	RFC (Replication Factor C, 5 subunits)
Okazaki fragment length	1000-2000 nt	100-200 nt
Telomere replication	Not required (circular genome)	Telomerase (extends telomeres)

Eukaryotic Licensing and Initiation:

Phase	Event
G₁ phase	ORC binds origins → Cdc6, Cdt1 load MCM helicase (pre-Replication Complex, pre-RC)
S phase	CDK (Cyclin-Dependent Kinase) and DDK (Dbf4-Dependent Kinase) activate origins
Initiation	MCM activated; Cdc45, GINS, DNA pol α-primase recruited
Elongation	PCNA loaded by RFC; Pol δ and Pol ε extend

3.4 Telomeres and Telomerase

Telomere Structure:

Repetitive DNA sequences at chromosome ends (TTAGGG in humans)
Length: 5-15 kb in humans
Shelterin complex: TRF1, TRF2, POT1, TPP1, TIN2, RAP1 (protects chromosome ends from being recognized as double-strand breaks)

End Replication Problem (Olovnikov, 1971): Lagging strand cannot fully replicate the 3′ end because the last RNA primer leaves a gap after removal → progressive shortening each cell division.

Telomerase:

Component	Function
TERT (Telomerase Reverse Transcriptase)	Catalytic subunit; synthesizes telomeric repeats using RNA template (reverse transcriptase activity)
TERC (Telomerase RNA Component)	Provides template (3′ -CCCAAUCCC-5′ in humans; complementary to TTAGGG)
Dyskerin	Binds RNA; stabilizes complex
TCAB1	Localizes complex to Cajal bodies for assembly

Telomerase Activity in Different Cell Types:

Cell Type	Telomerase Activity
Germ cells	High (maintains telomere length across generations)
Stem cells (embryonic, adult)	Moderate (slows telomere shortening, but still shortens with age)
Most somatic cells	Undetectable (telomeres shorten with each cell division)
Cancer cells	High (maintains telomere length; enables immortality)

3.5 DNA Repair Mechanisms

Repair Type	Damage	Mechanism	Proteins
Mismatch repair (MMR)	Base mismatches, insertion/deletion loops (replication errors)	Detects mismatch; excises segment (~100-1000 bp); resynthesizes	MutS, MutL (prokaryotes); MSH, MLH, PMS (eukaryotes)
Base excision repair (BER)	Single damaged base (deamination, oxidation, alkylation)	Removes base (glycosylase); cuts backbone (AP endonuclease); replaces 1-10 nt	DNA glycosylase, APE1, DNA pol β, ligase
Nucleotide excision repair (NER)	Bulky lesions (pyrimidine dimers from UV, adducts from chemicals)	Removes ~24-32 nt segment (includes damaged base); resynthesizes	XPA-G, ERCC1, CSA, CSB (eukaryotes)
Homologous recombination (HR)	Double-strand breaks (in S/G₂ phase)	Uses sister chromatid as template (error-free)	BRCA1, BRCA2, RAD51, MRN complex
Non-homologous end joining (NHEJ)	Double-strand breaks (in G₁ phase)	Joins broken ends directly (error-prone; small insertions/deletions)	Ku70/80, DNA-PKcs, XRCC4, Ligase IV

PART 4: TRANSCRIPTION

4.1 Prokaryotic Transcription (E. coli)

RNA Polymerase Holoenzyme (E. coli):

Subunit	Function
α (alpha, 2 copies)	Assembly; binds UP element
β (beta)	Catalytic (polymerase activity)
β’ (beta-prime)	DNA binding
ω (omega)	Assembly, stability
σ (sigma, σ⁷⁰ in normal growth)	Promoter recognition (binds -10 and -35 boxes); dissociates after initiation

Promoter Structure (E. coli σ⁷⁰ promoters):

Element	Consensus Sequence	Position	Function
-35 box	TTGACA	35 bp upstream	σ⁷⁰ recognition
-10 box (Pribnow box)	TATAAT	10 bp upstream	Melting (AT-rich)
UP element	A-rich	Further upstream	α subunit binding

Transcription Cycle:

Phase	Steps
Initiation	RNA polymerase binds promoter (closed complex) → melts DNA (open complex, ~12 bp) → initiates RNA synthesis (abortive initiation, short transcripts released)
Promoter escape	σ subunit released; core polymerase escapes promoter
Elongation	RNA synthesized 5’→3′ (complementary to template strand; RNA matches coding strand with U instead of T); transcription bubble (~18 bp) moves
Termination	Rho-independent (intrinsic): Hairpin loop + poly-U in RNA → polymerase dissociates. Rho-dependent: Rho factor binds rut site; ATP-dependent helicase activity releases transcript

4.2 Eukaryotic Transcription

Three RNA Polymerases:

Polymerase	Location	Products	Promoter Elements
RNA pol I	Nucleolus	rRNA (18S, 5.8S, 28S pre-rRNA)	UCE (Upstream Control Element), core promoter
RNA pol II	Nucleoplasm	mRNA, snRNA, some snRNA	TATA box, Inr (Initiator), BRE, DPE, downstream elements
RNA pol III	Nucleoplasm	tRNA, 5S rRNA, U6 snRNA, some other small RNAs	Type 1, 2, 3 promoters (internal or upstream)

RNA Polymerase II Promoter Elements:

Element	Consensus Sequence	Position	Binds
TATA box	TATAAA	-30 to -25	TBP (TATA-binding protein)
BRE (TFIIB Recognition Element)	G/C-G/C-G/C-G	Upstream of TATA	TFIIB
Inr (Initiator)	YYANWYY (Y = C/T, W = A/T)	+1 (transcription start)	TAFs
DPE (Downstream Promoter Element)	RGAYGTGG	+28 to +32	TAFs
CAAT box	GGCCAATCT	-80 to -70	NF1, CTF
GC box	GGGCGG	Multiple	Sp1 (Specificity protein 1)

Transcription Factors (GTFs) for RNA Pol II:

Factor	Function
TFIIA	Stabilizes TBP-DNA binding
TFIIB	Bridges pol II and TFIIF; positions polymerase
TFIID (TBP + TAFs)	Recognizes TATA box (TBP); core promoter recognition (TAFs)
TFIIE	Recruits TFIIH; stimulates ATPase and helicase
TFIIF	Binds pol II; prevents nonspecific DNA binding; facilitates elongation
TFIIH	Kinase (phosphorylates CTD of pol II for initiation); helicase (unwinds DNA); XPB, XPD subunits (NER repair)

RNA Processing (Eukaryotes):

Process	Location	Description
5′ capping	Co-transcriptional (nucleus)	7-methylguanosine cap added (protects from degradation; ribosome binding; export)
3′ polyadenylation	Co-transcriptional (nucleus)	Poly-A polymerase adds ~200 A residues (stability; export; translation efficiency)
Splicing	Co-transcriptional (nucleus)	Intron removal; exon joining; catalyzed by spliceosome (snRNPs: U1, U2, U4, U5, U6)

Alternative Splicing: One gene can produce multiple protein isoforms by selectively joining different exons.

Types of Alternative Splicing:

Type	Description
Exon skipping	Exon included or excluded
Mutually exclusive exons	Exactly one of two exons included
Alternative 5′ splice site	Different 5′ splice sites
Alternative 3′ splice site	Different 3′ splice sites
Intron retention	Intron retained (rare in animals; common in plants)

PART 5: TRANSLATION (PROTEIN SYNTHESIS)

5.1 Components of Translation

Component	Prokaryotes	Eukaryotes
Ribosome	70S (50S + 30S)	80S (60S + 40S)
rRNA	23S, 16S, 5S	28S, 18S, 5.8S, 5S
mRNA	Polycistronic (multiple genes)	Monocistronic (one gene)
tRNA	30-50 types	50-100 types
Initiation codon	AUG (fMet-tRNA; formyl-methionine)	AUG (Met-tRNA)
Shine-Dalgarno sequence	GGAGG (ribosome binding site, 5′ of AUG)	Not present (scanning from 5′ cap)
Initiation factors	IF1, IF2, IF3	eIF1, eIF1A, eIF2, eIF3, eIF4E, eIF4G, eIF5, eIF5B, eIF6

Ribosome Structure:

Subunit	Prokaryotes	Eukaryotes	Sites
Small	30S (16S rRNA + 21 proteins)	40S (18S rRNA + 33 proteins)	mRNA binding; decoding (A site)
Large	50S (23S, 5S rRNAs + 34 proteins)	60S (28S, 5.8S, 5S rRNAs + 49 proteins)	Peptidyl transferase (rRNA, ribozyme); A, P, E sites

tRNA Structure:

Secondary: Cloverleaf (acceptor stem, D loop, anticodon loop, TΨC loop, variable loop)
Tertiary: L-shaped (folded)
Anticodon: 3 bases complementary to mRNA codon
Acceptor stem: 3′-CCA (amino acid attached to 3′-OH of adenosine)

Aminoacyl-tRNA Synthetase (aaRS):

20 types (one per amino acid)
Catalyzes: Amino acid + tRNA + ATP → Aminoacyl-tRNA + AMP + PPᵢ
Proofreading: Hydrolyzes mischarged aminoacyl-tRNA (error rate < 1 in 10,000)

5.2 Genetic Code

Feature	Description
Codon	3 nucleotides (triplet)
Number of codons	64 (4³)
Sense codons	61 (encode 20 amino acids)
Stop codons	UAA, UAG, UGA (no corresponding amino acid)
Start codon	AUG (methionine in eukaryotes; formyl-methionine in prokaryotes)
Degeneracy	Most amino acids have multiple codons
Wobble hypothesis	First base of anticodon can pair non-standardly with third base of codon (e.g., G pairs with U or C; I pairs with A, U, or C)
Universality	Almost universal (exceptions: mitochondria, some protozoa)

5.3 Translation Cycle

Prokaryotic Initiation:

Step	Event
1	30S subunit + IF1 + IF3 bind
2	IF2-GTP binds
3	mRNA binds (Shine-Dalgarno sequence pairs with 16S rRNA anti-Shine-Dalgarno)
4	fMet-tRNAᴹᵉᵗ binds start codon (AUG) in P site
5	50S subunit joins (IF1, IF3 released; IF2 hydrolyzes GTP → GDP + Pi)

Eukaryotic Initiation (Scanning Model):

Step	Event
1	eIF2-GTP + Met-tRNAᴹᵉᵗ + eIF3 bind 40S subunit (43S pre-initiation complex)
2	eIF4E binds 5′ cap; eIF4G bridges eIF4E, eIF3, and PABP (poly-A-binding protein)
3	43S complex scans from 5′ cap to first AUG (Kozak sequence: GCCRCCaugG)
4	AUG recognition triggers eIF5 (GTPase-activating protein); eIF2 hydrolyzes GTP
5	60S subunit joins (eIF5B hydrolyzes GTP)

Elongation (Prokaryotic factors; eukaryotic analogous):

Step	Prokaryotic Factors	Event
1. Aminoacyl-tRNA binding	EF-Tu (with GTP)	Delivers aa-tRNA to A site (correct codon-anticodon base pairing)
	EF-Ts (recharges EF-Tu)	GDP → GTP exchange
2. Peptide bond formation	Peptidyl transferase (23S rRNA)	Peptide bond between P site and A site; polypeptide transferred to A site tRNA
3. Translocation	EF-G (with GTP)	Ribosome moves 3′ along mRNA (one codon); deacylated tRNA moves to E site; peptidyl-tRNA moves to P site

Termination:

Step	Prokaryotes	Eukaryotes	Event
1	RF1 (UAA, UAG) or RF2 (UAA, UGA)	eRF1 (all stops; eRF3, GTPase)	Stop codon in A site recognized by release factor
2	RF3 (GTPase, stimulates release)	eRF3 (GTPase)	Polypeptide released from P site
3	Ribosome recycling factor (RRF) + EF-G	ABCE1 (ATPase)	Ribosome dissociates

PART 6: GENE REGULATION

6.1 Prokaryotic Gene Regulation (Lac Operon)

Components of Lac Operon:

Element	Function
Promoter (lacP)	RNA polymerase binding site
Operator (lacO)	Repressor binding site
lacZ	β-galactosidase (cleaves lactose into glucose + galactose; also converts lactose to allolactose)
lacY	Permease (transports lactose into cell)
lacA	Transacetylase (acetylates lactose; function unclear)
lacI (repressor)	Constitutively expressed (own promoter); tetramer binds operator when lactose absent

Regulation by Lac Repressor:

Condition	Lac Repressor	Transcription
Lactose absent	LacI tetramer binds operator; blocks RNA polymerase	OFF
Lactose present	Allolactose (inducer) binds repressor; repressor dissociates from operator	ON (low, unless glucose absent)

Catabolite Repression (Glucose Effect):

Condition	cAMP level	CAP-cAMP complex	Transcription
Glucose present	Low (cAMP from adenylate cyclase)	Does not form	Low (even if lactose present)
Glucose absent	High (cAMP from adenylate cyclase)	Binds CAP site near promoter; enhances RNA polymerase binding	High (if lactose present)

6.2 Eukaryotic Gene Regulation

Level	Mechanism
Chromatin remodeling	Histone acetylation (HATs; relaxes chromatin, increases transcription); deacetylation (HDACs; condenses chromatin, decreases transcription); ATP-dependent chromatin remodelers (SWI/SNF, ISWI, CHD, INO80)
DNA methylation	CpG islands (often in promoters) methylated (5-methylcytosine) → gene repression; maintained through cell division (maintenance methyltransferase)
Transcriptional regulation	Transcription factors (activators, repressors) bind enhancers or silencers; co-activators (CBP/p300, Mediator complex) bridge transcription factors and RNA pol II
RNA processing	Alternative splicing; RNA editing (A→I, C→U)
mRNA stability	AU-rich elements (AREs) in 3′ UTR (destabilize mRNA); miRNA binding (RISC complex, degradation or translational repression)
Translation	Iron response elements (IRE) in ferritin mRNA (bind IRP; block translation when iron low); upstream open reading frames (uORFs)
Protein stability	Ubiquitination (proteasomal degradation); phosphorylation (activation/inactivation)

Enhancer Mechanisms:

DNA looping (proteins bound at enhancer interact with proteins at promoter via Mediator complex)
Enhancers can be upstream, downstream, or within introns
Tissue-specific enhancers (e.g., immunoglobulin enhancer only in B cells)

PART 7: RECOMBINANT DNA TECHNOLOGY

7.1 Key Enzymes

Enzyme	Source	Recognition Sequence	Cut type	Overhang
EcoRI	E. coli RY13	5′-GAATTC-3′ (palindromic)	Sticky (cohesive)	5′ overhang (AATT)
HindIII	Haemophilus influenzae Rd	5′-AAGCTT-3′	Sticky	5′ overhang (AGCT)
BamHI	Bacillus amyloliquefaciens H	5′-GGATCC-3′	Sticky	5′ overhang (GATC)
SmaI	Serratia marcescens	5′-CCCGGG-3′	Blunt	—
TaqI	Thermus aquaticus	5′-TCGA-3′	Sticky	5′ overhang (CG)
NotI	Nocardia otitidis-caviarum	5′-GCGGCCGC-3′	Sticky	5′ overhang (GGCC) (rare cutter)

Other Important Enzymes:

Enzyme	Function
DNA ligase	Joins DNA fragments (seals nicks)
T4 DNA ligase	Ligates sticky or blunt ends (from T4 bacteriophage)
Alkaline phosphatase (CIP, SAP)	Removes 5′ phosphate (prevents self-ligation)
Polynucleotide kinase (PNK)	Adds 5′ phosphate (for ligation)
Reverse transcriptase	RNA → cDNA (from retroviruses; AMV, M-MLV)
Taq DNA polymerase	PCR (thermostable; 5’→3′ polymerase; 5’→3′ exonuclease; no 3’→5′ proofreading)
Pfu DNA polymerase	PCR (thermostable; with 3’→5′ proofreading; lower error rate)

7.2 Cloning Vectors

Vector	Insert Size	Features	Use
Plasmid	0.1-10 kb	Ori, selectable marker (antibiotic resistance), MCS	Gene cloning, expression
Bacteriophage λ	10-20 kb	Cos sites; packaging into phage heads	Genomic libraries
Cosmid	35-45 kb	Plasmid + cos sites	Large inserts
BAC (Bacterial Artificial Chromosome)	100-300 kb	F-factor based; low copy (1-2 per cell)	Genomic libraries, genome projects
YAC (Yeast Artificial Chromosome)	100-2000 kb	Telomeres, centromere, ARS	Large genomic fragments, human genome project
Ti plasmid (Agrobacterium)	Variable	T-DNA (transferred to plant genome); vir genes	Plant transformation
Shuttle vector	Variable	Origin for multiple hosts (E. coli + yeast, E. coli + mammalian)	Gene transfer between species

7.3 Polymerase Chain Reaction (PCR)

Components:

DNA template (target sequence)
Primers (forward and reverse, 18-25 nt, Tm ~50-65°C)
dNTPs (dATP, dGTP, dCTP, dTTP)
DNA polymerase (Taq, Pfu, Phusion, Q5)
Buffer (Mg²⁺, KCl, Tris-HCl, pH 8.3-9.0)

Thermal Cycling:

Step	Temperature	Time	Cycles	Purpose
Initial denaturation	94-98°C	2-5 min	1	Fully denature DNA
Denaturation	94-98°C	15-30 sec	25-40	Separate strands
Annealing	50-65°C	15-60 sec	25-40	Primers bind
Extension	72°C	1 min per kb	25-40	Polymerase extends
Final extension	72°C	5-10 min	1	Complete incomplete extensions

PCR Variants:

Variant	Purpose	Modification
RT-PCR	Detect RNA	Reverse transcriptase first (RNA → cDNA)
qPCR (real-time PCR)	Quantify DNA/RNA	SYBR Green or TaqMan probe (fluorescence monitored each cycle)
Nested PCR	Increase specificity	Two rounds of PCR (second with internal primers)
Multiplex PCR	Amplify multiple targets	Multiple primer pairs
Inverse PCR	Amplify unknown flanking sequences	Primers oriented outward; circularized template
Long-range PCR	Amplify long fragments (>10 kb)	Polymerase mix (Taq + proofreading polymerase)

7.4 DNA Sequencing

Sanger Sequencing (Chain Termination Method):

Component	Function
DNA template	Target sequence
Primer	Initiates synthesis
DNA polymerase	Extends
dNTPs (dATP, dGTP, dCTP, dTTP)	Chain elongation
ddNTPs (ddATP, ddGTP, ddCTP, ddTTP, each with different fluorescent dye)	Chain termination (no 3′-OH)

Principle: Random incorporation of ddNTPs terminates synthesis at different positions → fragments of different lengths; capillary electrophoresis separates fragments by size; laser detects fluorescent dye.

Read length: 500-1000 bp

Next-Generation Sequencing (NGS):

Platform	Method	Read length	Throughput	Error type
Illumina (SBS)	Reversible dye terminators; bridge amplification	50-300 bp	Very high (terabases)	Substitutions (phasing errors)
Ion Torrent (PGM, Proton)	Semiconductor (pH change from H⁺ release during polymerization)	200-400 bp	Medium (gigabases)	Indels (homopolymer errors)
Pacific Biosciences (SMRT)	Single molecule; real-time; zero-mode waveguides	10-25 kb	Low-medium (gigabases)	Indels (random errors)
Oxford Nanopore	Protein nanopore; current change as DNA passes through	10-1000+ kb	Medium (gigabases)	Substitutions, indels

7.5 Gene Expression Analysis

Technique	Principle	Quantification	Uses
Northern blot	RNA electrophoresis; transfer to membrane; probe hybridization	Semi-quantitative	Detect specific RNA; RNA size
RT-qPCR	Reverse transcriptase + real-time PCR (SYBR Green or TaqMan)	Absolute or relative (ΔΔCt)	Quantify specific mRNA expression
RNA-seq	Convert RNA to cDNA; NGS; align reads to transcriptome; count reads per gene	Absolute (transcripts per million, TPM; fragments per kilobase per million, FPKM)	Whole transcriptome expression; discover new transcripts; alternative splicing
Microarray	Probe spots on chip;

BTH-2062 Introduction to Biotechnology – Complete Study Notes

Course Overview

Introduction to Biotechnology is a foundational course that explores the application of biological systems, organisms, or derivatives to create or modify products for specific uses. The course integrates principles from molecular biology, microbiology, biochemistry, and engineering to address challenges in medicine, agriculture, industry, and the environment.

Core Question: How can we harness biological processes and manipulate living organisms to develop technologies and products that benefit humanity and the environment?

Prerequisites: Introductory biology (cell structure, genetics, metabolism) and basic chemistry.

PART 1: DEFINING BIOTECHNOLOGY

1.1 What is Biotechnology?

Biotechnology is the integration of natural sciences and engineering sciences to achieve the application of organisms, cells, parts thereof, and molecular analogues for products and services.

UN Convention on Biological Diversity (CBD) definition:
“Any technological application that uses biological systems, living organisms, or derivatives thereof, to make or modify products or processes for specific use.”

Key characteristics:

Exploits biological processes (fermentation, enzyme catalysis, genetic recombination)
Uses living organisms (microbes, plants, animal cells) or their components (enzymes, DNA)
Creates or modifies products and processes for human benefit

1.2 Historical Development of Biotechnology

Period	Era	Key Developments	Examples
Ancient (pre-1800)	Traditional biotechnology	Fermentation for food preservation; selective breeding of plants and animals; cheese, yogurt, bread, wine, beer, fermented vegetables, idli, dosa, tempeh	Egyptians used yeast for bread (~4000 BCE); Sumerians brewed beer (~6000 BCE); Babylonians used selective breeding for date palms
Classical (1800-1950)	Microbiology and fermentation	Pasteur’s germ theory (1861); pure culture techniques; discovery of enzymes; fermentation technology for industrial chemicals; microbial production of citric acid, butanol, acetone; production of antibiotics (penicillin, 1928; large-scale WWII)	Louis Pasteur – pasteurization, rabies vaccine; Emil von Behring – diphtheria antitoxin; Alexander Fleming – penicillin discovery; Selman Waksman – streptomycin (1943)
Modern (1950-1980)	Molecular biology and genetic engineering	Discovery of DNA structure (1953); recombinant DNA technology (1973); restriction enzymes (1970s); DNA sequencing (Sanger, 1977); production of human insulin in E. coli (1982); PCR (1985)	Cohen & Boyer – first recombinant DNA; Genentech – first recombinant protein (somatostatin, 1977) and human insulin (1982); Kary Mullis – PCR invention (Nobel 1993)
Post-genomic (1990-present)	Genomics, proteomics, synthetic biology	Human Genome Project (1990-2003); gene therapy trials; CRISPR-Cas9 (2012); RNA vaccines (COVID-19 pandemic, 2020); personalized medicine; CAR-T cell therapy; induced pluripotent stem cells (iPSCs, 2006, Yamanaka); synthetic biology (synthetic genomes, minimal cells, metabolic engineering)	Human Genome Project (completed 2003, draft 2001); CRISPR-Cas9 (Doudna, Charpentier, Nobel 2020); mRNA vaccines (BioNTech/Pfizer, Moderna); first CRISPR therapy approval (Casgevy for sickle cell disease, UK 2023)

1.3 Branches of Biotechnology (Color-Coded Classification)

Branch	Color	Focus	Applications
Red biotechnology (medical)	Red	Human health, pharmaceuticals, diagnostics, gene therapy	Recombinant proteins (insulin, growth hormone, clotting factors, monoclonal antibodies); vaccines (mRNA, viral vector, recombinant subunit); gene therapy (Luxturna, Zolgensma, Casgevy); stem cell therapy; CAR-T cell therapy (Kymriah, Yescarta); diagnostics (PCR, ELISA, biosensors, CRISPR-based diagnostics)
Green biotechnology (agricultural)	Green	Crop improvement, plant biotechnology, biofertilizers	Genetically modified (GM) crops: herbicide-resistant (Roundup Ready soybean, corn, canola); insect-resistant (Bt cotton, Bt corn, Bt brinjal, Bt eggplant); virus-resistant (Rainbow papaya, PRSV-resistant); nutritional enhancement (Golden Rice – beta-carotene); abiotic stress tolerance (drought-tolerant corn, salt-tolerant rice); marker-assisted breeding (MAS); tissue culture (micropropagation, somaclonal variation)
White biotechnology (industrial)	White	Industrial processes, enzymes, biofuels, bioplastics	Industrial enzymes: proteases (detergents, leather), lipases (biodiesel, detergents), amylases (starch hydrolysis, brewing, textiles), cellulases (biofuels, textile finishing), xylanases (paper bleaching), pectinases (juice clarification); fermentation: amino acids (glutamic acid, lysine), organic acids (citric acid, lactic acid); biofuels: bioethanol (from corn, sugarcane, lignocellulosic biomass), biodiesel (from vegetable oils, waste cooking oil), biogas (methane from anaerobic digestion), biobutanol; bioplastics: PLA (polylactic acid), PHB (polyhydroxybutyrate), PHA (polyhydroxyalkanoates)
Blue biotechnology (marine/aquatic)	Blue	Marine organisms, aquaculture, marine-derived products	Marine natural products: anticancer agents (bryostatin from bryozoans, didemnin B from tunicates), anti-inflammatory (pseudopterosins from soft corals), antimicrobials; algal biotechnology: microalgae (biofuels, DHA, astaxanthin, beta-carotene, phycobiliproteins), macroalgae (agar, carrageenan, alginate, food, fertilizers); aquaculture: breeding, disease diagnostics, vaccines for fish, probiotics; biosensors: marine organisms as environmental sensors; cosmeceuticals: marine collagen, anti-aging compounds from algae
Yellow biotechnology (insect)	Yellow	Insect biotechnology, insect-derived products, pest control	Insect-resistant crops (Bt toxins, cry genes); insect cell culture (baculovirus expression system – protein production); silkworm biotechnology (silk production, recombinant silk proteins); insect pheromones for pest control (mating disruption, attractants for trapping); sterile insect technique (SIT, mass rearing, sterilization using radiation, genetic sexing); RNAi-based pest control (dsRNA targeting essential insect genes); insect-derived enzymes and proteins
Brown biotechnology (arid/desert)	Brown	Arid land management, desert agriculture	Drought-tolerant crops (transgenic and marker-assisted breeding); salt-tolerant (halophyte) crops; soil stabilization using microorganisms (microbial polymers, cyanobacteria crusts); bio-reclamation of desertified land; water conservation and wastewater treatment; biosaline agriculture (use of brackish water for irrigation); restoration of degraded ecosystems; extremophile microorganisms (thermophiles, halophiles) for industrial processes in hot climates
Grey biotechnology (environmental)	Grey	Bioremediation, pollution control, waste treatment, environmental monitoring	Bioremediation: oil spills (hydrocarbon-degrading bacteria Pseudomonas, Alcanivorax), heavy metals (bioaccumulation, biosorption, phytoremediation using hyperaccumulator plants), pesticides and herbicides (microbial degradation, phytoremediation), industrial effluents (dyes, solvents, heavy metals, organic pollutants); wastewater treatment: activated sludge, anaerobic digestion, membrane bioreactors (MBRs), constructed wetlands; bioplastics from waste streams (PHA from organic waste); bioleaching (recovery of metals from ores using bacteria, e.g., Acidithiobacillus ferrooxidans); biosensors for environmental monitoring (microbial biosensors, whole-cell biosensors, enzyme-based biosensors for pollutants, heavy metals, pathogens); biostimulation (nutrient addition to indigenous microbes) and bioaugmentation (addition of specialized microbes) for contaminated sites
Gold biotechnology (bioinformatics)	Gold	Computational biology, data analysis, genomics, bioinformatics	DNA sequencing analysis (genome assembly, annotation, variant calling, whole genome sequencing (WGS), exome sequencing (WES)); database management (GenBank, UniProt, PDB, GEO, SRA, dbSNP, ClinVar); sequence alignment (BLAST, multiple sequence alignment, Clustal Omega, MUSCLE, MAFFT); phylogenetic analysis (MEGA, BEAST, MrBayes); protein structure prediction (homology modeling, Swiss-Model, AlphaFold, RoseTTAFold, molecular dynamics); systems biology (network analysis, metabolic modeling); machine learning in genomics (predicting regulatory elements, variant effects, gene expression, protein function, drug-target interactions); personalized medicine (pharmacogenomics, variant interpretation, clinical decision support)

PART 2: MOLECULAR BIOLOGY TECHNIQUES

2.1 DNA Isolation and Purification

Principle: Separation of DNA from cellular components (proteins, lipids, carbohydrates, RNA) using physical (cell lysis, centrifugation, precipitation) and chemical (detergents, chaotropic agents, organic solvents) methods.

General steps:

Step	Purpose	Reagents/Methods
1. Cell lysis	Break open cells and nuclei	Detergents (SDS, Triton X-100, CTAB for plant tissues), enzymes (lysozyme for bacteria, proteinase K for tissue), mechanical disruption (bead beating, mortar and pestle with liquid nitrogen for plant tissues, sonication, freeze-thaw), chaotropic agents (guanidinium thiocyanate for silica column)
2. Removal of proteins, lipids, carbohydrates	Purify DNA from contaminants	Organic extraction (phenol:chloroform:isoamyl alcohol – denatures proteins; chloroform extracts lipids); proteinase K (digests proteins); sodium acetate (precipitates proteins, especially after phenol extraction). For plant tissues: addition of CTAB (cetyltrimethylammonium bromide) binds to polysaccharides and removes them; also RNase A to remove RNA. Silica column binding (under chaotropic conditions, DNA binds to silica, contaminants are washed away).
3. DNA precipitation	Concentrate DNA	Cold isopropanol or ethanol (95-100%) with sodium acetate (salt neutralizes negative charges on DNA phosphate backbone, allowing aggregation). High salt concentration (NaCl, sodium acetate, ammonium acetate) for ethanol precipitation.
4. Washing	Remove residual salt and organic solvents	70% ethanol (removes salt, does not dissolve DNA as readily as water; DNA pellet is less soluble in 70% ethanol than in water; washes away salt)
5. Resuspension	Dissolve DNA in buffer	TE buffer (Tris-EDTA, pH 8.0 – EDTA chelates Mg²⁺, inhibiting DNases); nuclease-free water (avoid shearing, use wide-bore pipette tips)

Common DNA extraction methods:

Phenol-chloroform extraction: Traditional; yields high molecular weight DNA; uses toxic organic solvents
Silica column (spin column): Fast, uses chaotropic salts (guanidinium thiocyanate), DNA binds to silica membrane; contaminants washed away; eluted in low-salt buffer
Magnetic bead method: DNA binds to magnetic beads in presence of PEG (polyethylene glycol) and salt; beads separated with magnet; simple, scalable
CTAB method: For plants (removes polysaccharides and polyphenols)
Chelex resin (for PCR templates): Chelex binds divalent metal ions (Mg²⁺, Ca²⁺) that can inhibit PCR; rapid, crude extraction for forensic samples (DNA remains in supernatant after boiling; Chelex chelates Mg²⁺, preventing DNase activity but also downstream PCR? For PCR, Mg²⁺ is required, so Chelex is used at low concentration, or Mg²⁺ is added later in PCR mix to restore optimal Mg²⁺ concentration). Used in forensic DNA analysis.

2.2 Gel Electrophoresis (DNA/RNA)

Principle: Separation of nucleic acids (DNA, RNA) by size in an agarose or polyacrylamide gel under electric field (negatively charged phosphate backbone migrates toward positive electrode). Smaller fragments migrate faster through gel matrix.

Parameter	Agarose Gel	Polyacrylamide Gel
Resolution range	100 bp – 20 kb (for DNA)	10 bp – 500 bp (for DNA)
Pore size	Adjustable by agarose % (0.5-2.5%)	Adjustable by acrylamide % (5-20%)
Applications	Routine DNA/RNA analysis, PCR product checking, restriction digest analysis, gel extraction, Southern/Northern blot	DNA sequencing (Sanger), high-resolution analysis, protein electrophoresis (SDS-PAGE), small DNA fragments, DNA footprinting
Post-staining	Ethidium bromide (EtBr), SYBR Safe/Gold, GelRed	SYBR Gold, silver staining, ethidium bromide (for small fragments; ethidium bromide diffuses out of gel, less sensitive for small fragments than SYBR Gold).
Sample loading	DNA sample + loading dye (glycerol or Ficoll for density, bromophenol blue/xylene cyanol for tracking)	Same as agarose (but for protein gels, Coomassie Blue or silver staining after electrophoresis)
Running buffer	TAE (Tris-acetate-EDTA) or TBE (Tris-borate-EDTA)	TBE for polyacrylamide (used for DNA sequencing)

Visualization:

UV transilluminator (254 nm, 302 nm, 365 nm) for ethidium bromide (EtBr) (EtBr intercalates between DNA bases, fluoresces under UV light, emits at 590 nm (orange-red))
Blue light (470 nm) for SYBR Safe (safer, less DNA damage; SYBR Safe is less mutagenic than EtBr and can be used with blue light transilluminators)
Gel documentation system (camera, filters, software for image capture and analysis)

DNA ladder (size marker): Commercial mixture of DNA fragments of known sizes (100 bp ladder, 1 kb ladder, 100 bp plus ladder, lambda DNA/HindIII digest, phiX174/HaeIII digest).

2.3 Polymerase Chain Reaction (PCR)

Definition: In vitro method for exponential amplification of specific DNA sequences using a thermostable DNA polymerase (Taq, Pfu, Q5, Phusion, KOD, etc.) and primers.

Components:

Component	Function	Typical Concentration
Template DNA	Source of target sequence	10 pg – 1 μg (depending on sample type; genomic DNA vs. plasmid, cDNA)
Forward primer	Binds to sense strand; defines 5′ end of amplicon	0.1-0.5 μM
Reverse primer	Binds to antisense strand; defines 3′ end of amplicon	0.1-0.5 μM
Thermostable DNA polymerase	Synthesizes new DNA strand (5’→3′ polymerization; may have 3’→5′ proofreading exonuclease (Pfu, Q5, Phusion, KOD) or not (Taq)	0.5-2.5 U (units) per 50 μL reaction
dNTPs (dATP, dTTP, dCTP, dGTP)	Building blocks for DNA synthesis	200 μM each (200-250 μM)
MgCl₂ (or MgSO₄)	Cofactor for DNA polymerase (required for activity; binds to active site)	1.5-2.5 mM (for Taq; optimal depends on template and primer-dimer formation)
Buffer	Provides optimal pH (8.0-9.0) and ionic strength (KCl, Tris-HCl, (NH₄)₂SO₄); may contain additives (BSA, DMSO, betaine, formamide, glycerol, Tween 20, Triton X-100) to improve amplification of GC-rich templates or remove secondary structure	1× (provided by manufacturer)

PCR thermal cycling steps:

Step	Temperature	Duration	Purpose	Number of Cycles
Initial denaturation	94-98°C	2-5 min	Denature double-stranded DNA into single strands; activate hot-start polymerase (heat activation, e.g., for antibody-bound, chemical modification, or aptamer-bound polymerases)	1
Denaturation	94-98°C	20-30 sec	Separate DNA strands (for subsequent cycles)	25-40
Annealing	50-65°C	20-30 sec	Primers bind (anneal) to complementary sequences on template strands	25-40
Extension	72°C (Taq optimal); 68°C (Pfu, Phusion)	1 min per kb of target	Polymerase synthesizes new DNA strand (extends from primer)	25-40
Final extension	72°C	5-10 min	Ensure all incomplete strands are fully extended (complete partial products)	1
Hold	4-10°C	indefinite	Store amplified product	–

Primer design guidelines:

Parameter	Optimal	Range
Length	18-24 nucleotides	18-30 nt
Melting temperature (T_m)	52-58°C (for routine PCR); higher for qPCR (60°C)	50-65°C
GC content	40-60%	30-70% (avoid extreme GC content, especially at 3′ end)
3′ end	Avoid G or C at the 3′ end (reduce mispriming; but for high specificity, G or C at 3′ end can increase efficiency if designed carefully; typically, avoid runs of Gs or Cs at 3′ end)	At least 2 G/C in last 5 bases (stronger binding at 3′ end improves extension efficiency); avoid complementary between primers (primer-dimer)
Primer-dimer check	No self-complementarity or complementarity between forward and reverse primers at 3′ ends	Avoid 3′ overlaps (3′ complementarity leads to primer-dimer formation, reducing yield)
T_m difference between primers	≤ 5°C	Annealing temperature is usually set 5°C below lower T_m
Amplicon size	100-500 bp (for routine PCR); 50-150 bp (for qPCR)	50-2000 bp

Primer T_m calculation (nearest neighbor method, Wallace rule for short primers (14-20 nt)):

For short primers (<20 nt): T_m ≈ 2°C × (A+T) + 4°C × (G+C) (simplified Wallace rule; not accurate for longer primers). For longer primers, use nearest neighbor thermodynamic calculations (ΔH, ΔS) with software (Primer3, OligoCalc, NCBI Primer-BLAST) to estimate T_m. Salt concentration (Na⁺, Mg²⁺) also affects T_m (higher salt increases T_m).

Types of PCR:

PCR Variant	Modification	Application
Reverse transcription PCR (RT-PCR)	Reverse transcriptase converts RNA to cDNA first, then PCR	Detect RNA expression; detect RNA viruses; measure gene expression (relative quantification)
Quantitative PCR (qPCR, real-time PCR)	Fluorescent dyes (SYBR Green, intercalating) or probes (TaqMan) monitor amplification in real-time; Cq (quantification cycle) value correlates with starting template quantity	Quantify DNA or RNA (gene expression, copy number, viral load); allelic discrimination; SNP genotyping; high-resolution melting (HRM) analysis
Nested PCR	Two rounds of PCR (outer primers first, inner primers nested within first product on second round)	Increase specificity (for low target abundance or degraded templates); reduce non-specific amplification; useful for difficult templates (e.g., metagenomic samples, ancient DNA)
Multiplex PCR	Multiple primer pairs in single reaction	Amplify multiple targets simultaneously (e.g., pathogen detection, genotyping)
Colony PCR	Direct PCR from bacterial colonies (using cells as template; lysis by heating at 95°C in initial denaturation step, without DNA extraction)	Screen clones for insert verification
Inverse PCR	Primers oriented outward from known sequence; circularized DNA fragment	Amplify unknown flanking regions (genome walking, identification of insertion sites, transposon mapping, retroviral integration sites)
Asymmetric PCR	One primer in excess (50:1 to 100:1 ratio) to produce single-stranded DNA (ssDNA)	Single-stranded DNA for sequencing (Sanger sequencing requires ssDNA template, but linear amplification from one primer produces ssDNA; more commonly, single-stranded DNA is produced by PCR with one primer in large excess or by using magnetic beads with streptavidin-biotin capture)
Overlap extension PCR (OE-PCR)	Splicing two DNA fragments using overlapping primers	Create fusion genes; site-directed mutagenesis; gene splicing (SOEing – splicing by overlap extension)
Long-range PCR	Special polymerases (Taq + proofreading enzyme blend)	Amplify long fragments (10-40 kb) for cloning, mapping (physical mapping)
Hot-start PCR	Polymerase is inactive at room temperature (via antibody binding, chemical modification, or aptamer), activated at 95°C	Reduce non-specific priming (prevents mispriming at low temperatures during reaction setup)
Touchdown PCR	Annealing temperature decreases gradually (e.g., 65°C to 55°C) over cycles	Increase specificity (early cycles use higher T_annealing to ensure specific priming; later cycles use lower T_annealing to increase yield)

2.4 Reverse Transcription PCR (RT-PCR)

Purpose: Detect and quantify RNA (gene expression, RNA viruses, splicing variants) by converting RNA to complementary DNA (cDNA) using reverse transcriptase, followed by PCR amplification of cDNA.

Steps:

RNA → (Reverse transcriptase) → cDNA → (PCR) → dsDNA (amplicon)

Reverse transcriptase enzymes:

Enzyme	Source	Features	Optimal Temperature
M-MLV RT (Moloney Murine Leukemia Virus)	Retrovirus	RNase H activity (can degrade RNA in RNA-DNA hybrid; may reduce yield); lower processivity; less thermostable; available as RNase H-minus mutant (SuperScript II, III, IV) for higher yield and longer cDNA transcripts.	37-42°C
AMV RT (Avian Myeloblastosis Virus)	Retrovirus	RNase H activity; higher thermostability (can be used at 50-55°C, reducing RNA secondary structure)	42-50°C
Engineered M-MLV variants (SuperScript II, III, IV; ProtoScript)	Recombinant	RNase H-deficient (minimizes degradation of RNA during cDNA synthesis); higher processivity; improved thermostability (up to 55-60°C for SuperScript IV)	50-55°C

Primers for reverse transcription:

Primer Type	Specificity	Advantage	Disadvantage
Oligo(dT) (12-18 thymine nucleotides)	Binds to poly(A) tail of eukaryotic mRNA	Selective for mRNA (not ribosomal RNA or tRNA)	Does not work for prokaryotic RNA (no poly(A) tail); does not work for degraded RNA (poly(A) tail may be lost); may bind to internal A-rich sequences; does not reverse transcribe non-polyadenylated RNAs (e.g., some viruses, bacterial RNA, histone mRNAs, lncRNAs without polyA tail)
Random hexamers (6 random nucleotides)	Priming throughout RNA (any region with complementarity)	Can be used for any RNA (including degraded RNA, total RNA, prokaryotic RNA, viral RNA, small RNAs, non-coding RNAs)	Will also prime ribosomal RNA and tRNA, reducing coverage of mRNA; may produce shorter transcripts
Gene-specific primer (GSP)	Specific to target gene	Most specific (only reverse transcribes the target RNA)	Separate reaction needed for each target (not for high-throughput); must design primer for each gene; not suitable for multiplex RT

Two-step vs. One-step RT-PCR:

Feature	Two-step RT-PCR	One-step RT-PCR
Workflow	Reverse transcription (cDNA synthesis) in separate reaction; then use cDNA as template for PCR	Reverse transcription and PCR in single tube (reverse transcriptase + DNA polymerase + both primers; RT first, then PCR without opening tube)
Sensitivity	High (can use separate reactions for RT and PCR with optimized buffers; more cDNA available for multiple PCR assays)	Lower (single tube; all components in one reaction; can be less efficient due to buffer incompatibility; but convenient)
Convenience	More steps (open tube between RT and PCR; risk of contamination)	Simple (closed tube; less risk of contamination)
Multiplexing	cDNA can be split into multiple PCRs (high throughput; can analyze many genes from one cDNA pool)	Limited (difficult to multiplex)
Best for	Gene expression analysis (multiple targets), large-scale studies	Rapid detection (single target, pathogen detection; high throughput not required)

2.5 Quantitative PCR (qPCR)

Definition: Real-time monitoring of PCR amplification by measuring fluorescence at each cycle, enabling quantification of starting DNA or RNA (after reverse transcription) levels.

Detection chemistries:

Chemistry	Principle	Advantages	Disadvantages	Applications
SYBR Green I (intercalating dye)	Dye binds to double-stranded DNA (dsDNA), emits fluorescence; fluorescence increases as dsDNA accumulates (during extension).	Inexpensive; simple; no probe design required; works with any dsDNA amplicon (any target, just requires primers).	Non-specific (binds to any dsDNA, including primer-dimer, non-specific amplicons); requires melt curve analysis (post-amplification melting curve) to verify specificity (single peak for specific product; multiple peaks indicate non-specific products or primer-dimer).	Gene expression (relative quantification), genotyping (when coupled with HRM, high-resolution melting), screening, copy number estimation (if carefully designed)
TaqMan probe (hydrolysis probe)	Probe with fluorescent reporter (FAM, VIC, HEX, TET, Cy5, ROX) and quencher (TAMRA, BHQ, Eclipse, MGB, Iowa Black) anneals to target sequence; during extension, Taq polymerase 5’→3′ exonuclease activity cleaves probe, separating reporter from quencher, increasing fluorescence.	High specificity (requires probe binding; reduces signal from non-specific products); can be multiplexed (multiple probes with different fluorophores for different targets in same reaction).	More expensive (requires labeled probe); probe design required (longer turnaround); not suitable for screening multiple targets without custom probes.	Pathogen detection, allelic discrimination (SNP genotyping), gene expression (absolute quantification), copy number variation (CNV) analysis
Molecular beacon	Hairpin probe with fluorophore and quencher at ends; in absence of target, hairpin keeps fluorophore and quencher close (fluorescence quenched); when bound to target, hairpin opens, separating fluorophore from quencher, allowing fluorescence.	High specificity (discriminates single mismatches better than TaqMan); suitable for SNP genotyping, mutation detection.	Complex design; less commonly used than TaqMan; difficult multiplexing.	SNP genotyping, mutation detection, real-time monitoring
Scorpion probe	Probe attached to primer (hairpin structure with fluorophore and quencher); when primer incorporated into amplicon, hairpin opens, fluorescence increases.	Rapid kinetics; high specificity; single-step detection.	Complex design; proprietary; less common.	SNP genotyping, mutation detection

qPCR quantification methods:

Method	Requirement	Application	Steps
Absolute quantification	Standard curve (known concentrations of target DNA, e.g., plasmid DNA with target sequence, synthetic DNA oligonucleotide, in vitro transcribed RNA for RT-qPCR)	Determine absolute copy number (viral load, copy number variation (CNV), transgene copy number)	Prepare serial dilutions of standard; run qPCR with standards and samples; plot Cq vs log copy number (standard curve); interpolate sample copy numbers from standard curve (with Cq value from sample, read copy number from standard curve).
Relative quantification (ΔΔCq method, Livak method)	Reference gene (housekeeping gene, internal control: GAPDH, β-actin, 18S rRNA, B2M, HPRT1, TBP, etc.) that is stably expressed across samples and treatments	Gene expression changes (fold change between treatments, e.g., treated vs. control, disease vs. normal)	Calculate ΔCq = Cq(target) – Cq(reference) (normalized to reference gene). Calculate ΔΔCq = ΔCq(treated) – ΔCq(control). Fold change = 2^{-ΔΔCq} (assuming PCR efficiency = 100% (E=2)). For correction for efficiency, use Pfaffl method (ΔΔCq corrected for different efficiencies of target and reference genes).

Melt curve analysis (SYBR Green qPCR, post-amplification dissociation curve):

After amplification, slowly increase temperature (ramp from 60°C to 95°C, 0.1-0.5°C increments)
Monitor fluorescence decrease as dsDNA denatures
Specific amplicon (single product) → single sharp peak (T_m, melting temperature, determined by GC content, length, and sequence)
Nonspecific products or primer-dimers → multiple peaks or broad peaks
Used to validate specificity of SYBR Green assays

PART 3: RECOMBINANT DNA TECHNOLOGY

3.1 Restriction Enzymes (Restriction Endonucleases)

Definition: Bacterial enzymes that recognize specific palindromic DNA sequences (restriction sites) and cleave DNA at or near those sequences. Part of bacterial defense system against foreign DNA (restriction-modification system).

Types (based on structure and cleavage):

Type	Recognition	Cleavage	Cofactors	Examples	Use in Cloning
Type I	Asymmetric, bipartite	~1000 bp away	ATP, SAM, Mg²⁺	EcoK, EcoB	Not useful (cleavage not at specific site)
Type II	Palindromic (4-8 bp)	Within recognition sequence	Mg²⁺	EcoRI, HindIII, BamHI, NotI, XbaI, SalI, KpnI, SmaI, XmaI	Most commonly used for molecular cloning; produce sticky ends (5′ or 3′ overhangs) or blunt ends.
Type III	Asymmetric	~25 bp away	ATP, Mg²⁺	EcoP15	Not useful
Type IIs	Asymmetric	Specific distance away (e.g., 5′ or 3′ outside recognition site)	Mg²⁺	BsaI, BsmBI, BbsI, BpiI	Used in Golden Gate assembly (Type IIs restriction enzymes cleave outside recognition site, producing non-palindromic overhangs; enables modular assembly of DNA parts).

Common Type II restriction enzymes:

Enzyme	Recognition Sequence (5’→3′)	Cut	Overhang (ends)	Isoschizomers (same recognition sequence, may have different cut patterns)
EcoRI	G↓A A T T C	G	AATTC	5′ sticky	RsrI (same recognition; cuts same position)
HindIII	A↓A G C T T	A	AGCTT	5′ sticky	HsuI
BamHI	G↓G A T C C	G	GATCC	5′ sticky	BstI
PstI	C T G C A↓G	CTGCA	G	3′ sticky	BspMAI
SalI	G↓T C G A C	G	TCGAC	5′ sticky	HgiCI
XbaI	T↓C T A G A	T	CTAGA	5′ sticky	–
NotI	G C↓G G C C G C	GC	GGCCGC	5′ sticky (rare cutter; 8 bp)	–
SmaI	C C C↓G G G	CCC	GGG	Blunt	XmaI (recognizes same CCCGGG but cuts between C and G, producing 5′ sticky ends)
EcoRV	G A T↓A T C	GAT	ATC	Blunt	–
KpnI	G G T A C↓C	GGTAC	C	3′ sticky	–
SacI	G A G C T↓C	GAGCT	C	3′ sticky	–

Restriction digestion reaction:

DNA + Restriction Enzyme + Buffer (optimal salt, pH) + BSA (optional, to stabilize enzyme and prevent adsorption to tube walls) → Incubate at 37°C (optimal temperature for most Type II enzymes) → (heat inactivation 65-80°C for 20 min; optional if enzyme is heat labile or required for downstream steps) → DNA fragments with compatible ends

Factors affecting restriction digestion:

Factor	Effect
DNA purity	Contaminants (phenol, ethanol, salts, SDS) inhibit enzyme activity (interfere with Mg²⁺ or denature enzyme)
Methylation	Some restriction enzymes are blocked by DNA methylation (dam methyltransferase methylates GATC, EcoRI not affected by dam; but EcoRI is blocked by CpG methylation? EcoRI is not blocked by CpG methylation; but many Type II enzymes are sensitive to methylation at their recognition site, e.g., MboI (GATC) blocked by dam methylation, ClaI blocked by dam methylation).
Star activity	Under non-optimal conditions (low ionic strength, high glycerol concentration >5%, high pH, presence of organic solvents, prolonged incubation), restriction enzymes may cut at sequences similar (but not identical) to recognition site (star activity).

3.2 DNA Ligase

Function: Catalyzes formation of phosphodiester bond between adjacent DNA fragments (seals nicks in DNA backbone).

Reaction: Requires ATP (for T4 DNA ligase) or NAD⁺ (for E. coli DNA ligase) as cofactor.

Uses in cloning:

Joining insert DNA (PCR product, restriction fragment) into vector (plasmid, cosmid, BAC)
Sealing nicks after ligation (forming circular recombinant DNA)
Joining adapters and linkers to DNA fragments

Factors affecting ligation:

Factor	Effect
Insert:vector molar ratio	3:1 (insert:vector) is typical for directional cloning (reduces vector self-ligation). For blunt ends, higher insert:vector ratio (5:1) is recommended due to lower efficiency.
DNA ends	Sticky ends (cohesive) ligate more efficiently than blunt ends (higher local concentration of compatible ends).
Ligase concentration	1-5 U per reaction (high concentration may increase self-ligation).
Temperature	16°C for sticky ends (4-16°C; room temperature (25°C) works but may increase blunt end ligation and may also increase vector self-ligation; 16°C optimal for sticky end ligation); 4°C for blunt ends (overnight; but room temperature also works with higher ligase concentration).
ATP	Required (included in ligase buffer; repeated freeze-thaw may degrade ATP).

3.3 Vectors for Cloning

Definition: DNA molecule (plasmid, virus, artificial chromosome) used to carry foreign genetic material into a host cell, where it can be replicated and expressed.

Plasmid vectors:

Feature	Function	Example
Origin of replication (ori)	Allows plasmid replication in host (e.g., pUC ori, pBR322 ori, ColE1 ori)	pUC19, pBR322, pBluescript, pET vectors
Multiple cloning site (MCS)	DNA region with multiple unique restriction sites (for cloning inserts)	polylinker sequence in pUC vectors (with lacZα for blue-white screening)
Selectable marker (antibiotic resistance)	Allows selection of transformed cells (ampicillin, kanamycin, tetracycline, chloramphenicol resistance)	bla (ampicillin resistance), kan (kanamycin resistance), tet (tetracycline resistance), cat (chloramphenicol acetyltransferase)
lacZα (for

BTH-3091 Microbial Biotechnology – Comprehensive Study Notes

These notes cover the fundamental principles and applications of microbial biotechnology, including the use of microorganisms for industrial, agricultural, medical, and environmental purposes. The content is suitable for undergraduate students in biotechnology, microbiology, and related fields.

Part 1: Foundations of Microbial Biotechnology

1.1 What is Microbial Biotechnology?

Microbial biotechnology is the application of microorganisms (bacteria, fungi, yeasts, algae, viruses) and their components to produce valuable products or perform useful processes for human benefit. It harnesses the metabolic diversity of microbes for industrial, agricultural, medical, and environmental applications.

Key Areas of Microbial Biotechnology:

Area	Applications
Industrial	Production of antibiotics, enzymes, organic acids, amino acids, vitamins, biopolymers
Agricultural	Biofertilizers, biopesticides, plant growth-promoting rhizobacteria (PGPR), biocontrol agents
Medical	Recombinant proteins (insulin, growth hormone), vaccines, probiotics, phage therapy
Food	Fermented foods (yogurt, cheese, bread), food additives, single-cell protein
Environmental	Bioremediation, wastewater treatment, biomining, bioleaching, biodegradation of pollutants
Energy	Biofuels (ethanol, biodiesel, biogas, hydrogen), microbial fuel cells

1.2 Microorganisms Used in Biotechnology

Microorganism	Domain	Characteristics	Applications
Escherichia coli	Bacteria	Well-characterized genetics; fast growth; easy to manipulate	Recombinant protein production; cloning host
Bacillus subtilis	Bacteria	Gram-positive; secretes proteins efficiently	Enzyme production (proteases, amylases)
Saccharomyces cerevisiae	Yeast (Fungi)	GRAS status (Generally Recognized as Safe); eukaryotic protein processing	Baking, brewing, ethanol production; recombinant protein expression
Pichia pastoris	Yeast (Fungi)	High cell density; strong inducible promoter (AOX1)	Industrial recombinant protein production (e.g., hepatitis B vaccine)
Aspergillus niger	Filamentous fungi	High secretion capacity; GRAS	Citric acid production; enzyme production (amylases, pectinases)
Streptomyces spp.	Bacteria	Secondary metabolite production	Antibiotics (streptomycin, tetracycline, erythromycin)
Lactobacillus spp.	Bacteria (LAB)	Lactic acid fermentation; probiotic properties	Yogurt, cheese, probiotic supplements
Corynebacterium glutamicum	Bacteria	Glutamate and lysine overproduction	Amino acid production (MSG, lysine)
Clostridium spp.	Bacteria	Solvent production (acetone, butanol, ethanol)	ABE fermentation; biofuel production
Pseudomonas spp.	Bacteria	Metabolic versatility; degrade xenobiotics	Bioremediation; bioplastic (PHB) production
Cyanobacteria	Bacteria	Photosynthetic; produce hydrogen, ethanol	Biofuels; CO₂ capture
Chlamydomonas reinhardtii	Algae (Eukarya)	Photosynthetic; genetic tractability	Biofuels (lipids, hydrogen); recombinant protein production

1.3 GRAS Status

GRAS (Generally Recognized as Safe) is a designation by the US FDA indicating that a substance (including a microorganism) is considered safe for use in food.

GRAS microorganisms: Saccharomyces cerevisiae, Lactobacillus species, Bacillus subtilis (certain strains), Aspergillus niger (for enzyme production), Streptomyces (some strains)

Part 2: Microbial Metabolism and Strain Development

2.1 Central Carbon Metabolism

Key Pathways:

Glycolysis (EMP pathway): Glucose → Pyruvate (produces ATP, NADH)
Pentose phosphate pathway: Glucose → Ribose-5-P (nucleotides) + NADPH
TCA cycle (Krebs cycle): Acetyl-CoA → CO₂ + NADH + FADH₂ + ATP
Fermentation: Pyruvate → Organic acids/alcohols (without oxygen)

Industrial Product Yield from Glucose:

Product	Pathway	Maximum Theoretical Yield (mol/mol glucose)
Ethanol	Glycolysis + fermentation	2.0
Lactic acid	Homolactic fermentation	2.0
Citric acid	TCA cycle	1.0
Glutamic acid	TCA cycle + amination	1.0
Lysine	TCA cycle + aspartate pathway	0.5-0.75

2.2 Strain Improvement Methods

Method	Description	Advantages	Disadvantages
Mutation and selection	Random mutagenesis (chemicals, UV) + screening for desirable traits	Simple, no prior knowledge required	Random, time-consuming, multiple rounds needed
Protoplast fusion	Fusion of microbial cells after removing cell wall	Combine genomes of different strains	Non-specific; random integration
Recombinant DNA technology	Introduction of specific genes via plasmids or integration	Precise, targeted, predictable	Requires genetic knowledge; regulatory oversight
Adaptive laboratory evolution	Long-term culture under selective pressure	Mimics natural evolution; uncovers novel mutations	Time-consuming (months)
Genome shuffling	Recursive protoplast fusion + recombination	Combines beneficial mutations from multiple strains	Requires protoplast formation

2.3 Metabolic Engineering

Definition: The targeted modification of cellular metabolic pathways using recombinant DNA technology to improve production of specific metabolites.

Strategies:

Strategy	Description	Example
Overexpression of rate-limiting enzymes	Increase gene copy number or use strong promoter	E. coli for insulin (overexpression of insulin gene)
Knockout of competing pathways	Delete genes leading to byproducts	Knockout of lactate dehydrogenase in E. coli for ethanol production
Heterologous pathway expression	Introduce pathway from other organism	Production of artemisinic acid (precursor of artemisinin) in S. cerevisiae
Co-factor engineering	Alter NAD(P)H/NAD(P)⁺ balance	Introduce transhydrogenase for NADPH regeneration
Transport engineering	Enhance product export or substrate import	Overexpress efflux pumps
Regulatory engineering	Modify transcription factors or promoters	Replace native promoter with inducible/ constitutive promoter

Case Study – Penicillin Production:

Original Penicillium chrysogenum produced 60 mg/L
Classical strain improvement (mutagenesis + screening) → 50-100 g/L (today)
Yield improvement: Overexpression of genes for biosynthesis (pcbAB, pcbC, penDE), deletion of side pathways, optimized fermentation

Part 3: Industrial Products from Microbial Biotechnology

3.1 Antibiotics

Definition: Secondary metabolites produced by microorganisms that inhibit or kill other microorganisms.

Antibiotic	Producing Organism	Target	Mechanism	Clinical Use
Penicillin G	Penicillium chrysogenum	Bacteria (Gram+)	Inhibits cell wall synthesis (transpeptidase)	Gram+ infections
Cephalosporin	Cephalosporium acremonium	Bacteria (Gram+/−)	Inhibits cell wall synthesis	Broad-spectrum
Streptomycin	Streptomyces griseus	Bacteria (Gram−)	Inhibits protein synthesis (30S ribosome)	Tuberculosis
Tetracycline	Streptomyces aureofaciens	Bacteria (Gram+/−)	Inhibits protein synthesis (30S ribosome)	Broad-spectrum
Erythromycin	Saccharopolyspora erythraea	Bacteria (Gram+)	Inhibits protein synthesis (50S ribosome)	Respiratory infections
Vancomycin	Amycolatopsis orientalis	Bacteria (Gram+)	Inhibits cell wall synthesis (D-Ala-D-Ala binding)	MRSA

Production Process:

Strain improvement (mutagenesis, screening)
Inoculum preparation (spore suspension)
Fermentation (aerobic, submerged, fed-batch)
Recovery (filtration, solvent extraction, precipitation)
Purification (crystallization, chromatography)

3.2 Organic Acids

Acid	Producing Organism	Substrate	Yield (g/L)	Applications
Citric acid	Aspergillus niger	Molasses, corn syrup	150-200	Food (acidulant, preservative), pharmaceuticals
Lactic acid	Lactobacillus delbrueckii, Rhizopus oryzae	Glucose, corn starch	100-150	Bioplastics (PLA), food, cosmetics
Gluconic acid	Aspergillus niger	Glucose	200-300	Food additive, cleaning agent
Itaconic acid	Aspergillus terreus	Glucose, molasses	80-100	Polymers, resins
Acetic acid	Acetobacter aceti	Ethanol	100-150	Vinegar
Succinic acid	Actinobacillus succinogenes	Glucose, glycerol	50-100	Bioplastics, solvents

Citric Acid Production (Aspergillus niger):

Substrate: Molasses (pretreated to remove metals)
Conditions: pH < 2.0 (prevents oxalic acid production), high sugar (14-22%), aerobic
Yield: 70-80% (g citric acid/g sugar consumed)

3.3 Amino Acids

Amino Acid	Producing Organism	Titer (g/L)	Applications
Glutamic acid (MSG)	Corynebacterium glutamicum	100-150	Flavor enhancer
Lysine	C. glutamicum	120-180	Animal feed supplement
Threonine	E. coli, C. glutamicum	100-120	Animal feed
Tryptophan	C. glutamicum, E. coli	50-80	Pharmaceuticals, animal feed
Phenylalanine	E. coli	50-60	Aspartame precursor
Methionine	C. glutamicum	40-60	Animal feed

Glutamic Acid Production (C. glutamicum):

Biotin limitation or addition of penicillin/Tween 60 causes cell membrane permeability change
Glutamate leaks out (no intracellular accumulation)
Ammonium salts as nitrogen source (provides NH₄⁺ for amination of α-ketoglutarate)
Yield: ~50% (g glutamic acid/g sugar)

3.4 Enzymes

Enzyme	Producing Organism	Applications
Proteases	Bacillus subtilis, B. licheniformis, Aspergillus oryzae	Detergents, leather processing, food (cheese making), meat tenderizers
Amylases	B. subtilis, A. oryzae	Starch hydrolysis, baking, brewing, paper, textile
Cellulases	Trichoderma reesei, A. niger	Biofuel (cellulose to glucose), textile (stone-washed jeans), pulp/paper
Lipases	Candida rugosa, Thermomyces lanuginosus	Detergents, biodiesel production, food processing
Pectinases	A. niger	Fruit juice clarification (removes pectin)
Glucose isomerase	Streptomyces spp.	High-fructose corn syrup production (glucose → fructose)
Lactase (β-galactosidase)	Kluyveromyces lactis, A. niger	Lactose hydrolysis (lactose-free dairy products)
DNA polymerases	Thermus aquaticus (Taq), Pyrococcus furiosus (Pfu)	PCR (molecular biology)
Restriction enzymes	E. coli (EcoRI), Haemophilus influenzae (HindIII)	Molecular cloning

Taq Polymerase:

Isolated from thermophilic bacterium Thermus aquaticus (found in hot springs)
Optimal temperature: 72°C
Heat-stable (half-life 40 min at 95°C)
Revolutionized PCR (no need to add fresh enzyme each cycle)

3.5 Biopolymers

Polymer	Producing Organism	Substrate	Applications
Polyhydroxyalkanoates (PHA)	Cupriavidus necator, Pseudomonas spp.	Glucose, vegetable oils	Biodegradable plastics (packaging, medical)
Polyhydroxybutyrate (PHB)	C. necator, Bacillus megaterium	Glucose, sucrose	Bioplastics
Xanthan gum	Xanthomonas campestris	Glucose, sucrose	Thickener (food, cosmetics, oil drilling)
Dextran	Leuconostoc mesenteroides	Sucrose	Plasma expander, chromatography media
Alginate	Azotobacter vinelandii, Pseudomonas aeruginosa	Glucose	Thickener, wound dressings
Cellulose	Acetobacter xylinus	Glucose	Hydrophilic dressings, audio membranes (for speakers)

PHA Production:

Accumulated as intracellular granules under nutrient limitation (N, P, O₂) with excess carbon
PHB is thermoplastic and biodegradable
Higher cost than petrochemical plastics (limited market)

3.6 Vitamins

Vitamin	Producing Organism	Titer (mg/L)	Applications
Vitamin B₂ (Riboflavin)	Ashbya gossypii, Bacillus subtilis	10-20	Food/feed supplement
Vitamin B₁₂ (Cobalamin)	Pseudomonas denitrificans, Propionibacterium freudenreichii	50-200	Supplements
Vitamin C (Ascorbic acid)	Gluconobacter oxydans (converts sorbitol to sorbose) + chemical steps	–	Supplement, preservative
Vitamin B₃ (Niacin)	Bacillus subtilis	10-20	Food additive
Vitamin B₅ (Pantothenate)	Bacillus subtilis, E. coli	10-30	Coenzyme A precursor
Vitamin B₉ (Folate)	Bacillus subtilis	5-10	Supplement

3.7 Recombinant Proteins (Pharmaceuticals)

Protein	Expression Host	Applications
Insulin	E. coli (A and B chains separately or proinsulin)	Diabetes treatment
Human growth hormone (hGH)	E. coli	Growth hormone deficiency
Interferon α-2b	E. coli	Hepatitis C, cancer
Erythropoietin (EPO)	CHO cells (mammalian)	Anemia
Tissue plasminogen activator (tPA)	CHO cells	Stroke, heart attack
Hepatitis B surface antigen (HBsAg)	Pichia pastoris	HBV vaccine
Human papillomavirus (HPV) vaccine	S. cerevisiae (virus-like particles)	Cervical cancer prevention
Antibodies (e.g., Trastuzumab)	CHO cells	Breast cancer (Herceptin)

Expression Host Comparison:

Host	Advantages	Disadvantages
E. coli	Fast growth (20 min doubling), high yield (up to 50% cell protein), simple media	No post-translational modifications; inclusion bodies (refolding required)
S. cerevisiae	Eukaryotic protein processing (disulfide bonds, some glycosylation)	Hyperglycosylation (yeast-specific mannosylation), lower yield
P. pastoris	High cell density; strong inducible promoter (AOX1); fewer glycosylation issues	Requires methanol for induction
CHO cells (mammalian)	Correct human glycosylation; proper folding/secretion	Slow growth; expensive media; low yield (<1 g/L)

Part 4: Fermentation Technology

4.1 Fermentation Modes

Mode	Operation	Advantages	Disadvantages	Applications
Batch	All nutrients added initially; no addition/removal during run	Simple; low contamination risk; low labor	Downtime between runs; substrate inhibition possible	Antibiotics (secondary metabolites), enzymes, biomass
Fed-batch	Nutrients added periodically or continuously	High cell density; extended production phase; avoids inhibition	Complex feeding strategy	Recombinant proteins, amino acids, organic acids
Continuous (Chemostat)	Fresh medium added; culture removed at same rate	Steady-state operation; high productivity	Contamination risk; strain instability	Wastewater treatment, single-cell protein, biofuels
Solid-state fermentation	Microorganisms grow on moist solid substrate without free water	Low water usage; high product concentration; simple equipment	Difficult to control pH/temperature; not suitable for all microbes	Enzyme production (A. niger on wheat bran), mushroom cultivation

4.2 Bioreactor Types

Type	Mixing	Aeration	Shear	Applications
Stirred tank (STR)	Mechanical impeller	Sparger (air bubbles)	High	Most processes (bacteria, yeast)
Air-lift	Bubbles drive circulation	Sparger at base	Low	Shear-sensitive (plant cells, mammalian cells)
Bubble column	Bubbles only	Sparger at base	Low	Simple fermentations, wastewater
Packed-bed	Flow through packed matrix	Passive or forced	Low	Immobilized cells/enzymes
Fluidized-bed	Upward flow suspends particles	Upward flow	Low	Immobilized cells

4.3 Fermentation Media

Component	Purpose	Examples
Carbon source	Energy and carbon skeleton	Glucose, sucrose, molasses, starch, corn syrup, vegetable oils
Nitrogen source	Protein synthesis; nucleotides	Ammonium salts, urea, soybean meal, yeast extract, peptone
Phosphate	ATP, nucleic acids, phospholipids	KH₂PO₄, K₂HPO₄
Sulfur	Amino acids (Cys, Met), cofactors	MgSO₄, (NH₄)₂SO₄
Trace elements	Enzyme cofactors	Fe, Mn, Zn, Cu, Co, Mo
Antifoam agents	Prevent foaming	Silicone oil, polypropylene glycol, vegetable oil
Buffers	Maintain pH	CaCO₃, phosphate
Precursors/inducers	Enhance production	Phenylacetic acid (penicillin precursor), IPTG (lac promoter inducer)

4.4 Downstream Processing

Stages:

Harvest: Separate cells from broth (centrifugation, filtration, sedimentation)
Cell disruption (for intracellular products): Mechanical (French press, bead mill, sonication), enzymatic (lysozyme), chemical (detergents)
Primary recovery: Precipitation (ammonium sulfate, ethanol), extraction (liquid-liquid), membrane filtration (ultrafiltration, microfiltration)
Purification: Chromatography (ion exchange, affinity, size exclusion, hydrophobic interaction)
Formulation: Concentration (evaporation, ultrafiltration), drying (spray drying, freeze drying, fluidized bed), sterilization (filtration for heat-sensitive products)

Part 5: Agricultural and Environmental Applications

5.1 Biofertilizers

Definition: Microorganisms that enhance nutrient availability to plants.

Type	Microorganism	Mechanism	Target Crops
Nitrogen-fixing (symbiotic)	Rhizobium spp. (legumes), Frankia (actinorhizal plants)	N₂ → NH₃ (nitrogenase)	Legumes (soybean, pea, clover); alder, casuarina
Nitrogen-fixing (free-living)	Azotobacter, Azospirillum, Clostridium	N₂ → NH₃ (nitrogenase)	Non-legumes (cereals, vegetables)
Phosphate-solubilizing	Bacillus megaterium, Pseudomonas spp., Aspergillus spp.	Organic acid production (dissolves insoluble phosphate)	Most crops
Potassium-solubilizing	Bacillus mucilaginosus	Organic acid production (releases K from minerals)	Most crops
Plant growth-promoting rhizobacteria (PGPR)	Pseudomonas fluorescens, Bacillus subtilis	Phytohormone production (IAA), siderophores (Fe chelation), ACC deaminase (reduces ethylene)	Most crops
Mycorrhizae	Arbuscular mycorrhizal fungi (AMF) (Glomus spp.)	Enhanced P, N, water uptake	Most crops (except brassicas, beets)

5.2 Biopesticides

Definition: Microorganisms or their products used to control pests (insects, pathogens, weeds).

Type	Microorganism	Target	Mechanism
Bacterial	Bacillus thuringiensis (Bt)	Lepidoptera (caterpillars), Coleoptera (beetles), Diptera (flies)	Cry toxins (δ-endotoxins) damage insect midgut
Bacterial	Bacillus subtilis	Fungal pathogens (powdery mildew, Fusarium)	Antifungal metabolites (iturin, surfactin)
Fungal	Beauveria bassiana	Many insects (thrips, aphids, whiteflies)	Spores penetrate cuticle; mycosis
Fungal	Metarhizium anisopliae	Grasshoppers, locusts, beetles	Spores penetrate cuticle; mycosis
Fungal	Trichoderma harzianum	Fungal pathogens (Pythium, Rhizoctonia)	Mycoparasitism; enzyme production (chitinase, glucanase)
Viral	Nucleopolyhedrovirus (NPV)	Specific insect pests (caterpillars)	Viral replication destroys infected cells
Nematode-based	Steinernema carpocapsae + Xenorhabdus bacteria	Soil insects (grubs, weevils)	Bacteria kill insect (septicemia)

Bt Toxin Mechanism:

Bt produces Cry protoxins as parasporal crystal
Cry ingested by insect; activated by alkaline pH (midgut)
Activated toxin binds to midgut receptors (cadherin)
Forms pores in midgut epithelium → cell lysis → insect death
Bt subsp. kurstaki (Btk): Lepidoptera; israelensis (Bti): Diptera (mosquitoes)

Genetically modified crops (Bt crops): Cry genes expressed constitutively in plants (cotton, corn, soybean) – reduces pesticide use but raises resistance concerns.

5.3 Bioremediation

Definition: Use of microorganisms to degrade or detoxify environmental pollutants.

Types:

Type	Definition	Examples
In situ	Treatment at contamination site	Oil spill bioremediation (beaches)
Ex situ	Excavation + treatment elsewhere	Biopiles, land farming, bioventing
Bioaugmentation	Addition of specialized degrading microbes	Cleanup of chlorinated solvents (Dehalococcoides)
Biostimulation	Addition of nutrients to stimulate indigenous microbes	Oil spill cleanup (N, P addition)

Examples of Bioremediation:

Pollutant	Degrading Microorganism	Conditions	Outcome
Petroleum hydrocarbons	Pseudomonas, Rhodococcus, Alcanivorax	Aerobic	CO₂ + H₂O + biomass
BTEX (benzene, toluene, ethylbenzene, xylene)	Pseudomonas putida	Aerobic	CO₂ + H₂O
Chlorinated solvents (PCE, TCE)	Dehalococcoides mccartyi	Anaerobic (reductive dechlorination)	Ethene + Cl⁻
Polychlorinated biphenyls (PCBs)	Burkholderia, Rhodococcus	Aerobic (co-metabolism)	Lower chlorinated biphenyls
PAHs (polycyclic aromatic hydrocarbons)	Mycobacterium, Sphingomonas	Aerobic	CO₂ + H₂O
Heavy metals	Geobacter (reduces U(VI) → U(IV)), Acidithiobacillus (leaching)	Anaerobic/aerobic	Immobilization or removal

Deepwater Horizon Oil Spill (2010):

Indigenous hydrocarbon-degrading bacteria (Alcanivorax, Cycloclasticus, Colwellia) proliferated after spill
Stimulated by oil + dispersants
Biodegradation removed significant fraction of spilled oil

5.4 Bioleaching and Biomining

Definition: Use of microorganisms to extract metals from ores.

Microorganism	Conditions	Metal	Mechanism
Acidithiobacillus ferrooxidans	Acidic (pH 1.5-2.5), aerobic	Cu, U, Au (indirect)	Fe²⁺ → Fe³⁺ (oxidation); Fe³⁺ oxidizes insoluble metal sulfides → soluble
Acidithiobacillus thiooxidans	Acidic, aerobic	Cu, S	S⁰ → H₂SO₄ (acid generation)
Leptospirillum ferrooxidans	Acidic, aerobic	Fe (oxidation)	Fe²⁺ → Fe³⁺
Sulfolobus spp. (thermophilic)	High temperature (70°C), acidic	Cu, Mo	Metal sulfide oxidation

Bioleaching of Copper (Chalcopyrite, CuFeS₂):

A. ferrooxidans oxidizes Fe²⁺ → Fe³⁺ (regenerates Fe³⁺)
Fe³⁺ oxidizes CuFeS₂: CuFeS₂ + 4Fe³⁺ → Cu²⁺ + 5Fe²⁺ + 2S⁰
S⁰ oxidized to H₂SO₄ (by A. thiooxidans)
Copper in solution recovered by solvent extraction + electrowinning

Advantages: Low-grade ores; less energy; lower SO₂ emissions

5.5 Wastewater Treatment

Microbial Processes:

Process	Microorganisms	Conditions	Removes	Product
Activated sludge	Bacteria, protozoa	Aerobic	Organic carbon (BOD/COD), nutrients (N,P)	CO₂, H₂O, biomass (sludge)
Trickling filter	Biofilm (bacteria, fungi)	Aerobic	Organic carbon	CO₂, H₂O
Anaerobic digestion	Methanogens (Methanobacterium, Methanosarcina)	Anaerobic	Organic carbon	Methane (biogas)
Nitrification	Nitrosomonas (NH₃ → NO₂⁻), Nitrobacter (NO₂⁻ → NO₃⁻)	Aerobic	Ammonia (NH₃)	Nitrate (NO₃⁻)
Denitrification	Pseudomonas, Paracoccus (NO₃⁻ → N₂)	Anoxic (no O₂; NO₃⁻ present)	Nitrate	N₂ gas
Phosphorus removal	Acinetobacter (PAOs)	Anaerobic + aerobic (alternating)	Phosphate (PO₄³⁻)	P-rich sludge
Constructed wetlands	Bacteria (rhizosphere), plants	Aerobic/anaerobic zones	BOD, nutrients, pathogens	Clean water

5.6 Biofuels

Biofuel	Feedstock	Microorganism	Process	Yield
Ethanol	Corn starch (US), sugarcane (Brazil), cellulose (lignocellulosic – future)	Saccharomyces cerevisiae, Zymomonas mobilis	Fermentation (glucose → ethanol + CO₂)	~400 L/metric ton corn
Biodiesel	Vegetable oils (soybean, palm, canola), waste cooking oil, algal lipids	Yarrowia lipolytica, Chlorella (lipid production); Lipase (transesterification)	Transesterification of triglycerides with methanol	~1000 L/hectare (soybean); >5000 L/hectare (algae)
Biogas (methane)	Organic waste (agricultural, municipal, food)	Methanogens (Archaea) + syntrophic bacteria	Anaerobic digestion (hydrolysis → acidogenesis → acetogenesis → methanogenesis)	0.3-0.6 m³/kg volatile solids
Butanol (biobutanol)	Corn, molasses, lignocellulose	Clostridium acetobutylicum (ABE fermentation)	Acetone-Butanol-Ethanol fermentation	~0.2 g/g glucose
Hydrogen (biohydrogen)	Glucose, organic waste	Enterobacter, Rhodobacter (photofermentation), Clostridium (dark fermentation)	Fermentation or photofermentation	1-4 mol H₂/mol glucose

ABE Fermentation (Clostridium acetobutylicum):

Products: Acetone, Butanol, Ethanol (3:6:1 ratio)
Butanol: Better fuel than ethanol (higher energy density; less corrosive)
Challenges: Low yield; butanol toxicity to microbes; recovery difficulty

Part 6: Medical Applications

6.1 Probiotics

Definition: Live microorganisms that confer health benefits when administered in adequate amounts.

Probiotic Strain	Potential Benefits
Lactobacillus rhamnosus GG	Prevention of antibiotic-associated diarrhea; atopic dermatitis (children)
Lactobacillus acidophilus	Lactose intolerance; cholesterol reduction
Bifidobacterium longum	Immune modulation; constipation
Saccharomyces boulardii	Prevention of Clostridium difficile colitis; traveler’s diarrhea
Lactobacillus plantarum	Irritable bowel syndrome (IBS)

Mechanisms: Competitive exclusion; production of antimicrobial substances (bacteriocins, organic acids); immune modulation; barrier function enhancement.

6.2 Prebiotics

Definition: Non-digestible food ingredients that stimulate growth/activity of beneficial intestinal bacteria.

Examples: Fructo-oligosaccharides (FOS), galacto-oligosaccharides (GOS), inulin, lactulose.

6.3 Phage Therapy

Definition: Use of bacteriophages (viruses that infect bacteria) to treat bacterial infections (alternative to antibiotics).

Advantages: Specificity (no effect on normal microbiota); self-replicating (single dose may suffice); effective against antibiotic-resistant bacteria.

Challenges: Regulatory pathway unclear; narrow host range (requires identification of infecting strain); bacterial resistance can develop.

Example: Phage therapy used in Georgia (Eliava Institute) for decades; approved for food safety (Listeria on meat, Salmonella on produce).

6.4 Vaccine Production

Vaccine Type	Production Method	Examples
Live attenuated	Mutagenesis or passage in cell culture	Measles, mumps, rubella (MMR), BCG, yellow fever, oral polio (OPV)
Inactivated (killed)	Chemical (formalin) or heat treatment	Influenza (injected), polio (IPV), rabies, hepatitis A
Subunit (recombinant protein)	Expression in E. coli, S. cerevisiae, or P. pastoris	Hepatitis B (HBsAg), HPV (VLPs), pertussis (acellular)
Polysaccharide conjugate	Bacterial polysaccharide + carrier protein	Pneumococcus, Haemophilus influenzae type b (Hib), meningococcus
Toxoid	Inactivated bacterial toxin	Diphtheria, tetanus
mRNA	In vitro transcription (cell-free)	COVID-19 (Pfizer-BioNTech, Moderna) – not microbial but uses bacterial plasmids for template

Hepatitis B Vaccine Production (P. pastoris):

HBsAg gene inserted into P. pastoris under AOX1 promoter
Methanol induction
Cells express HBsAg; self-assembles into virus-like particles (VLPs)
Purified VLPs (size similar to HBV but non-infectious) + adjuvant

Part 7: Molecular Tools and Genetic Engineering

7.1 Cloning Vectors for Microbes

Vector	Insert Size	Features	Host
Plasmid	<10 kb	Ori, selectable marker (antibiotic resistance), MCS	E. coli
Bacteriophage λ	10-20 kb	Cos site; linear genome	E. coli
Cosmid	30-45 kb	Plasmid + cos sites (in vitro packaging)	E. coli
BAC (Bacterial Artificial Chromosome)	100-300 kb	Based on E. coli F factor	E. coli
YAC (Yeast Artificial Chromosome)	200-2000 kb	Telomeres, centromere, ARS (autonomously replicating sequence)	S. cerevisiae
Shuttle vector	Variable	Replicates in two hosts (e.g., E. coli + S. cerevisiae)	Multiple hosts
Expression vector	Variable	Contains promoter (inducible or constitutive), RBS, terminator	E. coli, yeast, etc.

7.2 Gene Expression Systems in Microbes

E. coli Expression Systems:

Promoter	Inducer	Strength	Leakiness	Use
lac	IPTG	Medium	Moderate	General expression
T7 (bacteriophage)	IPTG (T7 RNA polymerase)	Very high	Low	High-level expression (pET vectors)
araBAD	L-arabinose	Medium-high	Very low	Titratable expression
trp	IAA (indoleacrylic acid)	Medium	Low	Tryptophan metabolism
tet	Tetracycline	Medium	Low	Tetracycline-inducible

Yeast Expression Systems:

System	Promoter	Inducer	Host
S. cerevisiae	GAL1, GAL10	Galactose	S. cerevisiae
P. pastoris	AOX1	Methanol	P. pastoris
P. pastoris	GAP	Constitutive (glucose)	P. pastoris

BTH-3101: Methods in Molecular Biology – Complete Study Notes

This course provides a comprehensive overview of the fundamental and advanced techniques used in molecular biology research. It covers the core principles behind DNA, RNA, and protein analysis and their applications in fields like medicine, biotechnology, and agriculture. These notes are organized to follow the logical progression of a molecular biology experiment, from nucleic acid manipulation to gene expression analysis and protein studies, and are based on standard curricula from leading universities.

PART ONE: INTRODUCTION AND FUNDAMENTAL TECHNIQUES

1.1 What are Methods in Molecular Biology?

This field refers to the set of experimental protocols used to study the structure, function, and interactions of biological molecules—primarily DNA, RNA, and proteins. These techniques allow researchers to isolate, analyze, and manipulate genetic material to understand life at a molecular level.

1.2 The Core “Toolkit”

Before performing complex experiments, a molecular biologist must master basic laboratory skills, including:

Aseptic Technique: Preventing contamination of cultures and reagents.
Solution Preparation: Accurately preparing buffers, media, and stock solutions.
Micropipetting: Precisely measuring very small volumes (µl and ml).
Documentation: Maintaining a detailed and organized laboratory notebook.

1.3 Safety and Ethics

Working with molecular biology reagents involves potential hazards. Standard Operating Procedures (SOPs) must be followed. Key safety areas include:

Chemical Safety: Handling mutagens like ethidium bromide and acrylamide.
Biological Safety: Working with potentially infectious agents (e.g., E. coli). Many experiments are conducted in a Category 2 (BSL-2) laboratory.
Radiological Safety: Safely using radioactive isotopes (e.g., ³²P, ³⁵S) for labeling.
Ethics and Legislation: Understanding regulations regarding working with Genetically Modified Organisms (GMOs) and animal models.

PART TWO: WORKING WITH DNA

2.1 DNA Isolation and Purification

The first step in most molecular biology experiments is isolating high-quality DNA.

Goal: Separate genomic or plasmid DNA from other cellular components (proteins, lipids, RNA).
Basic Steps:
1. Cell Lysis: Breaking open the cell membrane using detergents and enzymes (e.g., lysozyme).
2. Removal of Contaminants: Proteins are precipitated or digested using proteases (e.g., Proteinase K) or removed by organic extraction (e.g., phenol-chloroform).
3. DNA Precipitation: DNA is precipitated using alcohol (ethanol or isopropanol) and salt.
4. Quantification: Measuring the concentration and purity of the DNA using a spectrophotometer or fluorometer.

2.2 Restriction Enzymes and Agarose Gel Electrophoresis

Restriction Endonucleases are the “molecular scissors” that cut DNA at specific sequences, producing fragments of defined sizes. They recognize palindromic sequences 4-8 base pairs long.

Agarose Gel Electrophoresis is used to separate DNA fragments by size.

How it works: DNA is loaded into a gel made of agarose (a seaweed-derived polymer). When an electric current is applied, the negatively charged DNA migrates towards the positive electrode. The smaller the fragment, the faster and farther it travels.
Visualization: The gel is stained with a fluorescent dye (like ethidium bromide or GelRed) that binds to DNA, allowing the fragments to be seen under UV or blue light.
Applications:
- Analyzing restriction digest products.
- Verifying the size of a PCR product.
- Purifying specific DNA fragments from a gel for cloning.

2.3 Restriction Mapping and Analysis

By comparing the fragment sizes produced from single and double restriction enzyme digests, you can construct a restriction map, which is a linear diagram showing the relative locations of restriction sites along a DNA molecule.

2.4 DNA Sequencing

Sanger Sequencing (Chain Termination Method):
This was the standard method for many years. It uses modified nucleotides (dideoxynucleotides, or ddNTPs) that, when incorporated by DNA polymerase, terminate the growing DNA chain. This produces a series of fragments of different lengths, each ending with a specific ddNTP. These fragments are separated by capillary electrophoresis to determine the DNA sequence.

Next-Generation Sequencing (NGS):
NGS refers to high-throughput technologies that can sequence millions of DNA fragments in parallel.

General Workflow:
1. Library Preparation: DNA is fragmented, and specific adapters are ligated to the ends.
2. Sequencing: Massive parallel sequencing reactions occur on a flow cell (e.g., Illumina’s sequencing-by-synthesis).
3. Data Analysis: Bioinformatics tools assemble the millions of short reads into a complete sequence.
Applications: Whole-genome sequencing, transcriptome analysis (RNA-seq), and identifying genetic variants.

PART THREE: GENE CLONING AND LIBRARIES

3.1 Gene Cloning

The goal of gene cloning is to make many copies of a specific DNA fragment by inserting it into a small, self-replicating piece of DNA called a vector.

Vectors: Common vectors include plasmids (small circular DNA in bacteria) and bacteriophages. Vectors contain essential features for cloning:
- Origin of Replication (ori)
- Selectable marker (e.g., ampicillin resistance)
- Multiple Cloning Site (MCS): A region with many restriction enzyme recognition sites.
Key Enzymes for Cloning:
- DNA Ligase: The “molecular glue” that joins two DNA fragments together by forming a phosphodiester bond.
- DNA Polymerases: Used for synthesizing DNA (e.g., for PCR).
- Reverse Transcriptase: An enzyme that creates complementary DNA (cDNA) from an RNA template.
Transformation: The process of introducing the recombinant plasmid into a host cell (usually E. coli), which then replicates the plasmid and its insert.

3.2 Polymerase Chain Reaction (PCR)

PCR is an in vitro technique for rapidly amplifying a specific DNA sequence, generating millions of copies from a starting template. It requires:

DNA template
Primers (short, single-stranded DNA molecules)
DNA polymerase (heat-stable, e.g., Taq polymerase)
Nucleotides (dNTPs)

The PCR Cycle:

Denaturation (94-98°C): The double-stranded DNA template is heated to separate it into single strands.
Annealing (50-65°C): The temperature is lowered to allow the primers to bind (anneal) to their complementary sequences on the single-stranded DNA template.
Extension (72°C): DNA polymerase synthesizes a new DNA strand, starting from the primer.

These three steps are repeated for 25-35 cycles, resulting in exponential amplification of the target DNA.

Types of PCR

Type of PCR	Key Feature	Main Application
RT-PCR	Uses reverse transcriptase to make cDNA from an RNA template	Detecting the presence or absence of an RNA transcript
qPCR (Real-Time PCR)	Monitors the amplification of DNA in real-time, allowing quantification	Quantifying gene expression levels (e.g., TaqMan method)
Colony PCR	Directly uses bacterial colonies as the DNA template	Rapidly screening bacterial colonies for the presence of the correct DNA insert
Multiplex PCR	Uses multiple primer pairs in one reaction	Detecting several different DNA sequences at once

3.3 Molecular Cloning Strategy and Library Construction

cDNA Libraries: A cDNA library is a collection of cloned DNA copies of all the mRNA present in a specific cell type at a specific time. It represents the expressed genes (exons only, no introns).
Genomic Libraries: A genomic library contains the entire genome of an organism, including coding and non-coding regions (introns and regulatory sequences). It is constructed by cloning large fragments of total genomic DNA.

PART FOUR: WORKING WITH RNA AND GENE EXPRESSION

Analyzing RNA allows us to study which genes are being actively transcribed (“turned on”) in a cell.

4.1 RNA Isolation and Analysis

mRNA Enrichment: Unlike DNA, total RNA is mostly ribosomal RNA (rRNA). Many protocols use oligo-dT beads to bind the poly-A tail of mRNA, separating it from rRNA and tRNA.
Northern Blotting: This technique is used to detect and quantify specific RNA molecules.
1. RNA samples are separated by gel electrophoresis.
2. The RNA is transferred (blotted) to a membrane.
3. The membrane is probed with a labeled, complementary DNA or RNA sequence to detect the target RNA.
4. It is used for measuring transcript size and abundance.

4.2 Functional Genomics

Functional genomics aims to understand the function of genes and their regulatory networks.

Transcriptomics (Microarrays & RNA-seq):
- DNA Microarrays: A chip with thousands of probes, each representing a specific gene. Labeled cDNA from a sample is hybridized to the chip, allowing scientists to see the expression levels of thousands of genes simultaneously.
- RNA-seq: Using NGS to sequence the entire transcriptome. It provides a more detailed and quantitative view of gene expression than microarrays.
Measuring Translation: Techniques like polysome profiling can measure how efficiently mRNA is being translated into protein on ribosomes.

4.3 Gene Silencing

RNA Interference (RNAi): A method to silence gene expression by introducing small interfering RNA (siRNA) or short hairpin RNA (shRNA) molecules that bind to complementary mRNA and target it for degradation.
CRISPRi (CRISPR interference): A modified CRISPR system that uses a catalytically inactive Cas9 (dCas9) protein to bind to DNA and physically block transcription without cutting the DNA.

PART FIVE: WORKING WITH PROTEINS

5.1 Protein Expression and Purification

Expression: A gene is cloned into an expression vector, which contains the necessary regulatory sequences (e.g., a strong promoter) to produce large quantities of the protein in a host cell (e.g., E. coli).
Purification: The protein of interest is separated from all other cellular proteins, often by using a tag (e.g., 6xHis-tag) that binds to a specific column.

5.2 Protein Analysis

SDS-PAGE (Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis): This technique separates proteins by their molecular weight. The protein sample is treated with SDS, which denatures the protein and coats it with a negative charge, making them all have a similar charge-to-mass ratio.
Western Blotting (Immunoblotting): Used to detect a specific protein within a complex mixture.
1. Proteins are separated by SDS-PAGE.
2. They are transferred (blotted) from the gel to a membrane.
3. The membrane is incubated with a primary antibody that specifically binds to the protein of interest.
4. A secondary antibody (conjugated to an enzyme) binds to the primary antibody, allowing visualization of the protein band.

5.3 Protein-Protein and Protein-DNA Interactions

Technique	What it detects	Application
Yeast Two-Hybrid (Y2H) System	Protein-protein interactions	Identifying novel binding partners of a “bait” protein
Co-Immunoprecipitation (Co-IP)	Protein-protein interactions	Confirming an interaction between two known proteins in cell lysates
GST Pull-Down Assay	Protein-protein interactions	Testing for an interaction in vitro between purified proteins
Chromatin Immunoprecipitation (ChIP)	Protein-DNA interactions	Identifying which DNA sequences a specific protein (e.g., a transcription factor) binds to in the genome
Electrophoretic Mobility Shift Assay (EMSA)	Protein-DNA interactions	Determining if a purified protein can bind to a specific DNA sequence in vitro

PART SIX: MODIFYING GENOMES AND CELLS

6.1 Genome Editing

CRISPR/Cas9 System: A revolutionary tool for precise genome editing. It consists of two components: the Cas9 nuclease (which cuts DNA) and a guide RNA (gRNA) that directs Cas9 to a specific DNA sequence. This creates a double-strand break, which can disrupt a gene or be used to insert a new DNA sequence.
Other Nucleases: Prior to CRISPR, genome editing was done using engineered nucleases like Zinc Finger Nucleases (ZFNs) and TALENs, which are more complex and expensive to design.

6.2 Gene Therapy

The delivery of a functional gene into a patient’s cells to treat a disease caused by a genetic mutation. This can be done:

Ex Vivo: Cells are removed from the patient, genetically modified, and then returned.
In Vivo: A vector (often a virus) containing the therapeutic gene is directly injected into the patient.

PART SEVEN: CELL CULTURE AND MICROSCOPY

7.1 Cell Culture

Growing cells in a controlled, artificial environment (in vitro). This is a critical tool for studying cell biology and for producing proteins and viruses.

Types: Primary cells (taken directly from tissue) and immortalized cell lines (cancer cells that can divide indefinitely).
Maintenance: Cells are grown in sterile flasks with nutrient media, incubated at 37°C with 5% CO₂, and passaged (subcultured) when they reach confluence.
3D Cell Culture and Bioprinting: Newer techniques that allow cells to grow in three dimensions, better mimicking the environment inside the body. Bioprinting uses specialized printers to build 3D structures of living cells, which is promising for tissue engineering and drug testing.

7.2 Microscopy

Fluorescence Microscopy: Uses fluorescent dyes or proteins (e.g., GFP) to visualize specific cell structures or proteins.
Electron Microscopy (EM): Uses a beam of electrons to achieve extremely high resolution, allowing scientists to visualize the ultrastructure of cells and even individual molecules.

QUICK REFERENCE: COMMONLY USED TECHNIQUES AND THEIR PURPOSE

Technique	Main Purpose
PCR / RT-PCR / qPCR	DNA/cDNA amplification and gene expression quantification
Agarose Gel Electrophoresis	Size-separation and analysis of DNA fragments
DNA Sequencing (NGS)	Determining the exact order of nucleotides in a DNA molecule
Gene Cloning (Restriction/Ligase)	Isolating and replicating a specific DNA fragment
CRISPR/Cas9	Precise editing of genomes (knockout, knock-in)
cDNA/Genomic Library	Collection of all DNA/cDNA fragments from an organism
Northern Blotting	Detection and quantification of specific RNA molecules
RNAi / CRISPRi	Silencing (turning off) a specific gene
SDS-PAGE	Separation of proteins by molecular weight
Western Blotting	Detection of a specific protein using antibodies
Yeast Two-Hybrid / Co-IP	Analysis of protein-protein interactions
ChIP / EMSA	Analysis of protein-DNA interactions
Cell Culture	Growing cells in a controlled environment for experiments

GLOSSARY OF KEY TERMS

cDNA (Complementary DNA): DNA synthesized from an mRNA template using reverse transcriptase.
Cloning Vector: A DNA molecule (e.g., a plasmid) used to carry foreign genetic material into a host cell for replication.
CRISPR: A powerful gene-editing technology that uses a guide RNA to direct the Cas9 enzyme to a specific DNA sequence.
Electrophoresis: A technique for separating charged molecules (like DNA, RNA, or proteins) based on their size as they move through a gel in an electric field.
Genomics: The study of an organism’s entire genome, including all its genes and their interactions.
Hybridization: The process of a single-stranded DNA or RNA molecule binding to a complementary sequence to form a double-stranded molecule.
In Vitro: A process performed in a test tube or artificial environment, as opposed to inside a living organism.
Library (Genomic/cDNA): A collection of cloned DNA fragments representing either the entire genome (genomic library) or all the expressed mRNA (cDNA library) of an organism.
Polymerase Chain Reaction (PCR): A technique to exponentially amplify a specific segment of DNA using primers and a heat-stable DNA polymerase.
Primer: A short, single-stranded DNA sequence that serves as a starting point for DNA synthesis.
Probe: A labeled (e.g., radioactive or fluorescent) single-stranded DNA or RNA fragment used to detect a complementary sequence in a sample.
Protein-Protein Interaction (PPI): The physical contact between two or more protein molecules, which is fundamental to most cellular processes.
Restriction Enzyme (Endonuclease): An enzyme that cuts DNA at a specific recognition sequence.
Reverse Transcriptase: An enzyme that creates a complementary DNA (cDNA) strand from an RNA template.
Sequencing: The process of determining the precise order of nucleotides (A, T, G, C) in a DNA molecule.
Transcriptome: The complete set of RNA transcripts produced by the genome in a specific cell or tissue at a given time.

SAMPLE EXAMINATION QUESTIONS

Short Answer Questions:

Explain the key differences between cDNA and genomic DNA libraries. When would you use each one?
A researcher uses an RT-qPCR experiment to measure the mRNA levels of Gene X. What are the essential components of this reaction, and how does it provide quantitative data?
Describe the basic steps involved in creating a recombinant DNA molecule, from a gene of interest to a transformed bacterial colony.
What is the function of the following in molecular cloning: a) Restriction enzyme, b) DNA ligase, c) Antibiotic resistance gene?

Essay Questions:

Discuss the principles of the CRISPR/Cas9 system. Explain its advantages over older genome-editing technologies like Zinc Finger Nucleases (ZFNs) and its potential applications in gene therapy.
Compare and contrast the techniques of Southern blotting, Northern blotting, and Western blotting. For each, describe the molecule being detected, the probe used, and a typical research application.
You are given a task to investigate if a newly discovered protein, Protein X, interacts with Protein Y in living cells and whether Protein X binds to a specific DNA sequence suspected to be its promoter. What two techniques would you use for each experiment, and how would they provide evidence for these interactions?

These notes provide a comprehensive foundation for BTH-3101: Methods in Molecular Biology. The key to mastering this subject is understanding not just the “how” of each technique but also the “why”—the underlying principles that allow us to visualize, manipulate, and quantify the building blocks of life.

TH-3111: Biosafety, Biosecurity & Bioethics – Comprehensive Study Notes

Part 1: Biosafety – Foundations and Laboratory Practices

1.1 Definition and Scope

Biosafety: The containment principles, technologies, and practices implemented to prevent unintentional exposure to biological agents and toxins, or their accidental release into the environment. It focuses on protecting laboratory personnel, the community, and the environment from hazardous biological materials.

Key Objectives of Biosafety:

Objective	Description
Personnel protection	Prevent laboratory-acquired infections
Environmental protection	Prevent release of hazardous agents
Sample protection	Prevent cross-contamination of experiments
Public health	Prevent community exposure to pathogens

1.2 Risk Assessment and Risk Groups

Risk Group Classification (WHO):

Risk Group	Definition	Examples	Laboratory containment
RG1 (Low individual & community risk)	Unlikely to cause disease in healthy humans	E. coli K12, Bacillus subtilis, Saccharomyces cerevisiae	BSL-1
RG2 (Moderate individual risk; low community risk)	Can cause human disease but treatable/preventable; limited spread risk	Staphylococcus aureus, Salmonella, Hepatitis B virus, HIV	BSL-2
RG3 (High individual risk; low community risk)	Causes serious human disease; potential for spread; treatment available	Mycobacterium tuberculosis, Bacillus anthracis, SARS-CoV, rabies virus	BSL-3
RG4 (High individual & community risk)	Causes serious human disease; high risk of spread; no effective treatment	Ebola virus, Marburg virus, Lassa virus, smallpox	BSL-4

1.3 Biosafety Levels (BSL-1 to BSL-4)

Core Requirements:

Level	Practices	Safety equipment	Facility features
BSL-1	Standard microbiological practices (SMP); no specific containment	Open bench; lab coat; gloves (optional)	Sink; bench surface; lockable door
BSL-2	SMP + restricted access; biohazard signs; sharps precautions; decontamination	BSC (for aerosol-generating procedures); lab coat; gloves; face protection (as needed)	Autoclave available; eyewash; sink
BSL-3	BSL-2 + controlled access; medical surveillance; respiratory protection; specific training	BSC for all manipulations; solid-front gown; double gloves; respirator (N95/PAPR)	Separate building/ zone; HEPA-filtered exhaust; negative air flow; self-closing doors
BSL-4	BSL-3 + personnel change/shower; waste decontamination before exit	Positive pressure suit (or BSC in Class III cabinet); redundant HEPA filtration; chemical shower	Isolated building; dedicated air supply/exhaust; double HEPA filtration; autoclave in facility

1.4 Primary and Secondary Containment

Containment type	Definition	Examples
Primary containment	Protects personnel and environment from exposure to biological agents	Biological Safety Cabinets (BSCs), centrifuge safety cups, sealed rotors, personal protective equipment (PPE)
Secondary containment	Protects external environment from release of biological agents	Laboratory design, ventilation systems, sealed walls/floors/ceilings, airlocks, autoclaves

Biological Safety Cabinet (BSC) Classes:

Class	Protection	Airflow	Exhaust	Applications
Class I	Personnel & environment (no product protection)	Inward airflow (open front); HEPA exhaust	HEPA	Low-risk agents; no product protection needed
Class II, Type A1	Personnel, product, environment	30% exhaust (HEPA); 70% recirculated; positive plenum	Room (can be ducted)	BSL-1-3 (non-volatile toxins)
Class II, Type A2	Personnel, product, environment	30% exhaust (HEPA); 70% recirculated; negative plenum	Room or ducted	BSL-1-3 (limited volatile chemicals)
Class II, Type B1	Personnel, product, environment	60% exhaust (HEPA); 40% recirculated	Ducted (hard-ducted)	BSL-1-3 with volatile chemicals
Class II, Type B2	Personnel, product, environment	100% exhaust (no recirculation)	Ducted (hard-ducted)	BSL-1-3 with chemical/radionuclide use
Class III (Glove box)	Personnel, product, environment	Gas-tight enclosure; HEPA supply/exhaust	Double HEPA	BSL-4; highly hazardous agents

1.5 Personal Protective Equipment (PPE)

PPE item	Purpose	When to use
Lab coat	Protect clothing; minimize contamination	All laboratory work (BSL-1-4)
Gloves (nitrile, latex, butyl)	Hand protection; prevent contamination	Handling biological/chemical agents
Face shield / goggles	Protect eyes, face from splashes	Potential for splashes/aerosols
N95 respirator	Filter airborne particles (≥0.3 μm, 95% efficiency)	BSL-3; aerosol-generating procedures
PAPR (Powered Air-Purifying Respirator)	Positive pressure; HEPA-filtered air supply	BSL-4; extended work with hazardous agents
Positive pressure suit	Full-body encapsulation; supplied air	BSL-4
Shoe covers	Prevent spread of contamination	Restricted areas; BSL-2+
Head cover (hood)	Protect hair; prevent contamination	BSL-3+

1.6 Good Microbiological Practices (GMP) and Standard Operating Procedures (SOPs)

Core Good Microbiological Practices:

Practice	Rationale
Hand washing	Remove contamination after work
No eating, drinking, applying cosmetics	Prevent ingestion of agents
No mouth pipetting	Prevent exposure
Work surfaces decontaminated	Reduce contamination
Sharps precautions	Prevent needle-stick injuries
Proper labeling	Identify hazards
Minimize aerosols	Reduce inhalation risk
Decontaminate waste before disposal	Protect waste handlers

Decontamination Methods:

Method	Mechanism	Efficacy	Applications
Autoclaving (steam sterilization)	Saturated steam under pressure (121°C, 15 psi, 15-20 min)	Kills all microorganisms (including spores)	Biohazardous waste; media; glassware
Dry heat (oven)	High temperature (160-180°C, 2-4 hours)	Kills spores	Glassware (non-plastic)
Incineration	Complete combustion	Complete destruction	Animal carcasses; contaminated disposables
Chemical disinfection	Chemical inactivation	Variable (depends on agent, concentration, time)	Surface decontamination; liquid waste
UV irradiation	DNA damage (pyrimidine dimers)	Limited (surface only; no spores)	BSCs; air disinfection
Filtration (0.22 μm)	Physical removal (not inactivation)	Removes bacteria; not viruses	Heat-sensitive solutions

Common Chemical Disinfectants:

Disinfectant	Concentration	Contact time	Effective against	Limitations
Sodium hypochlorite (bleach)	0.5-10%	10-30 min	Bacteria, viruses, spores (10% solution)	Corrosive; inactivates by organic matter
Ethanol / Isopropanol	70%	1-5 min	Bacteria, enveloped viruses; not spores	Evaporates; flammable
Formaldehyde	2-8%	10-30 min	Spores, viruses, bacteria	Toxic; carcinogen
Glutaraldehyde	2%	10-30 min	Spores, viruses, bacteria	Toxic; irritant
Hydrogen peroxide	3-7%	10-30 min	Bacteria, viruses; spores (higher %)	Corrosive
Peracetic acid	0.2-0.5%	5-10 min	Spores, viruses, bacteria	Corrosive

Part 2: Biosecurity

2.1 Definition and Scope

Biosecurity: The protection of biological agents and toxins from unauthorized access, loss, theft, misuse, diversion, or intentional release. It addresses deliberate threats (theft, sabotage, bioterrorism) rather than accidental exposure.

Key Distinction:

Aspect	Biosafety	Biosecurity
Focus	Unintentional exposure; laboratory accidents	Intentional release; theft; misuse
Goal	Protect people, environment from accidental release	Protect biological materials from malicious actors
Measures	Containment, PPE, training	Access control, inventory, personnel reliability
Threat	Natural (accidental)	Deliberate (adversarial)

2.2 Biosecurity Risk Groups

Risk Group	Definition	Examples
RG1 (Low)	Unlikely to be weaponized; available in public domain	E. coli K12; B. subtilis
RG2 (Moderate)	Could be misused but limited consequences	S. aureus, HIV, HBV
RG3 (High)	Potential for weaponization; significant consequences	B. anthracis, Y. pestis, F. tularensis, SARS-CoV
RG4 (Very high)	High potential for weaponization; devastating consequences	Ebola, Marburg, smallpox

2.3 Select Agents and Toxins (US CDC/APHIS)

Select Agent List: Biological agents and toxins determined to have the potential to pose a severe threat to public health and safety (US regulation 42 CFR 73).

Select Agent Categories:

Category	Definition	Examples
HHS Select Agents	Threat to human health	Ebola, Marburg, Lassa, SARS-CoV (restricted), smallpox, Bacillus anthracis, Yersinia pestis
USDA Select Agents	Threat to animal health/agriculture	Foot-and-mouth disease virus, Brucella abortus, Mycobacterium bovis
Overlap (HHS/USDA)	Threat to both	Bacillus anthracis, Brucella suis, Yersinia pestis

Tier 1 Agents (highest risk): Ebola, Marburg, Bacillus anthracis, Yersinia pestis, smallpox, botulinum toxin (neurotoxin types A, B, E, F), Lassa, SARS-CoV (restricted), Francisella tularensis.

2.4 Biosecurity Measures

Measure	Description
Access control	Physical barriers (locks, key cards, biometrics) to restrict entry to authorized personnel
Inventory management	Tracking system for all select agents; regular reconciliation
Personnel reliability program	Background checks; ongoing monitoring; training; security awareness
Transport security	Secure transfer of agents; chain of custody
Incident response plan	Theft, loss, unauthorized access procedures
Cyber security	Protect electronic records; prevent unauthorized data access
Security risk assessment	Identify vulnerabilities; implement mitigation measures
Two-person rule	Dual authorization for access to Tier 1 agents

2.5 Dual-Use Research of Concern (DURC)

Definition: Research that, while intended for beneficial purposes, could be misused to pose a significant threat to public health, agriculture, or national security.

Seven Experimental Categories (US Policy):

Category	Example
1. Enhance pathogen transmissibility	Airborne transmission of H5N1 influenza
2. Enhance pathogen virulence	Enhanced lethality of mousepox
3. Defeat countermeasures	Antibiotic resistance; vaccine evasion
4. Increase pathogen stability	Environmental persistence of B. anthracis
5. Alter host range	Cross-species transmission
6. Enhance susceptibility of host	Immunosuppression
7. Generate novel pathogens	Synthetic creation of poliovirus

DURC Risk Mitigation:

Institutional Biosafety Committee (IBC) and Institutional Review Entity (IRE)
Risk-benefit analysis before funding
Communication review (redaction of sensitive details)
Alternative research approaches

2.6 Biorisk Management (CWA 15793)

Biorisk: Combination of biosafety and biosecurity risks.

Biorisk Management Framework:

Component	Description
Risk assessment	Identify hazards; evaluate likelihood and consequences; prioritize
Risk mitigation	Implement controls (engineering, administrative, PPE); reduce risk to acceptable level
Performance monitoring	Audits; inspections; incident reporting
Continual improvement	Review; update; training

Part 3: Bioethics

3.1 Definition and Scope

Bioethics: The systematic study of ethical, social, legal, and philosophical issues arising from advances in biology, medicine, and biotechnology. It addresses what is right and wrong in biological research and medical practice.

Branches of Bioethics:

Branch	Focus	Examples
Medical ethics	Clinical practice	Informed consent; end-of-life; confidentiality
Research ethics	Human and animal research	IRB review; animal welfare
Biotechnology ethics	Genetic engineering; synthetic biology	CRISPR; GMOs; cloning; gene therapy
Public health ethics	Population-level interventions	Vaccination mandates; quarantine; resource allocation

3.2 Core Ethical Principles (Beauchamp & Childress)

Principle	Definition	Application
Respect for autonomy	Respect patient’s right to self-determination; informed consent	Patient makes own medical decisions
Beneficence	Act in the patient’s best interest; promote good	Provide beneficial treatments
Non-maleficence	“First, do no harm” (Primum non nocere)	Avoid unnecessary risks
Justice	Fair distribution of benefits and burdens; equity	Resource allocation; access to healthcare

3.3 Informed Consent

Definition: The process by which a patient or research participant voluntarily confirms willingness to participate in a procedure or study, after being informed of all relevant aspects.

Elements of Informed Consent:

Element	Description
Information disclosure	Purpose, procedures, risks, benefits, alternatives
Comprehension	Participant understands the information
Voluntariness	Free from coercion or undue influence
Competence	Legally and mentally capable of consenting
Decision	Explicit agreement (written for research)

Exceptions to Informed Consent:

Emergency (life-threatening; consent impossible)
Waiver by IRB (minimal risk research)
Therapeutic privilege (withholding information if disclosure would harm patient – narrowly applied)

3.4 Research Ethics and IRB/IEC

Institutional Review Board (IRB) / Independent Ethics Committee (IEC): Committee that reviews, approves, and monitors research involving human subjects to ensure ethical standards.

IRB Review Categories:

Category	Description	Review level
Exempt	Minimal risk; educational tests; surveys (anonymous); public benefit programs	Exempt from full review
Expedited	Minimal risk; blood draws (limited volume); non-invasive procedures; benign interventions	Reviewed by one member
Full board	More than minimal risk; vulnerable populations; interventions	Reviewed by full committee

Vulnerable Populations Requiring Special Protections:

Children (parental permission + child assent)
Prisoners
Pregnant women, fetuses, neonates
Cognitively impaired
Economically/educationally disadvantaged
Employees (potential coercion)

3.5 Animal Research Ethics (3Rs)

The 3Rs (Russell & Burch, 1959):

R	Definition	Examples
Replacement	Use non-animal methods instead of animals	Cell cultures, computer models, human volunteers, lower organisms (invertebrates)
Reduction	Use fewer animals to obtain same amount of information	Improved experimental design; sharing data; pilot studies; statistical power analysis
Refinement	Minimize pain, suffering, distress; improve welfare	Anesthesia; analgesia; enrichment; humane endpoints

Institutional Animal Care and Use Committee (IACUC): Committee that reviews and approves animal research protocols (analogous to IRB for human subjects).

3.6 Key Bioethical Issues in Modern Biotechnology

A) Gene Editing (CRISPR-Cas9)

Application	Ethical concerns
Somatic cell editing	Safety (off-target effects); equitable access; informed consent
Germline editing (heritable)	Safety (off-target; mosaicism); eugenics; “designer babies”; unintended consequences for future generations; consent (future generations cannot consent)
Enhancement	Distinction between therapy and enhancement; equity; coercion; “playing God”

International consensus: Germline editing currently prohibited (or strongly restricted) in most countries (Oviedo Convention, 1997; Council of Europe; China originally allowed clinical trials? – China has since enacted stricter regulations). Moratorium recommended by many scientific bodies (NASEM 2017, WHO 2019), but research continues under oversight.

B) Cloning

Type	Definition	Ethical issues
Therapeutic cloning (somatic cell nuclear transfer – SCNT – for stem cells)	Create embryonic stem cells genetically identical to patient	Destruction of embryos; embryo status; moral status
Reproductive cloning	Create cloned human	Safety (high failure rate; abnormalities); identity; psychological harm; commodification; dignity

Current status: Reproductive cloning prohibited in most countries; therapeutic cloning legal in some (variable restrictions).

C) Stem Cell Research

Cell type	Source	Ethical issues
Embryonic stem cells (ESC)	Inner cell mass of blastocyst (embryo days 5-7)	Destruction of embryos; moral status of embryo; alternative sources (iPSCs)
Induced pluripotent stem cells (iPSC)	Adult somatic cells reprogrammed (Yamanaka factors: Oct4, Sox2, Klf4, c-Myc)	Minimal ethical concerns (no embryos)
Adult stem cells	Bone marrow, adipose, dental pulp	Minimal ethical concerns

D) Genetic Testing and Screening

Application	Ethical issues
Predictive testing (Huntington’s, BRCA)	Psychological harm; discrimination; informed consent for minors; right not to know
Prenatal testing (NIPT, amniocentesis)	Reproductive autonomy; disability rights; selective abortion
Preimplantation genetic diagnosis (PGD)	Selection of embryos; “designer babies”; slippery slope
Carrier screening	Reproductive decision-making; stigmatization
Direct-to-consumer (DTC) testing	Accuracy; interpretation without counseling; privacy; data security

E) Gene Therapy

Type	Definition	Ethical issues
Somatic gene therapy	Modify non-reproductive cells	Safety (immune response, insertional mutagenesis); high cost; access; informed consent
Germline gene therapy	Modify reproductive cells (heritable)	Same as germline editing (see above)
Ex vivo vs. in vivo	Cells modified outside body (ex vivo) vs. inside body (in vivo)	Ex vivo: more controlled; In vivo: delivery vectors (AAV, lentivirus) have risks

F) Synthetic Biology

Application	Ethical issues
Minimal genome / synthetic life (Mycoplasma laboratorium, JCVI-syn1.0, JCVI-syn3.0)	Playing God; definition of life; biosecurity (dual-use)
XNA (xenonucleic acids)	Unnatural genetic systems; unknown ecological consequences
Cell-free systems	Fewer ethical concerns (no living organism)
Metabolic engineering	Biosecurity (synthesis of toxins); environmental release (GMOs)

Part 4: Regulatory Frameworks and Guidelines

4.1 International Guidelines

Document	Issuing body	Focus
WHO Laboratory Biosafety Manual (4th edition, 2020)	World Health Organization	Laboratory biosafety; risk assessment; biorisk management
Cartagena Protocol on Biosafety (2000)	UN Convention on Biological Diversity	Transboundary movement of GMOs (Living Modified Organisms – LMOs)
Nagoya Protocol (2010)	UN Convention on Biological Diversity	Access and benefit-sharing of genetic resources
Universal Declaration on Bioethics and Human Rights (2005)	UNESCO	Ethical principles (consent, privacy, non-discrimination, benefit-sharing)
Convention on Biological Diversity (CBD, 1992)	UN	Biodiversity conservation; sustainable use; benefit-sharing
International Health Regulations (IHR 2005)	WHO	Global surveillance; response to public health emergencies

4.2 National Regulatory Frameworks (US Examples)

Regulation	Agency	Scope
NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules	NIH (Office of Science Policy)	rDNA; synthetic nucleic acids (institutional biosafety committees – IBCs)
Select Agent Regulations (42 CFR 73, 7 CFR 331, 9 CFR 121)	CDC / APHIS	Registration; security; transport; transfer of select agents
Bloodborne Pathogens Standard (29 CFR 1910.1030)	OSHA	Occupational exposure to bloodborne pathogens (HBV, HCV, HIV)
Occupational Exposure to Hazardous Chemicals in Laboratories (29 CFR 1910.1450)	OSHA	Chemical hygiene plan; laboratory safety
Common Rule (45 CFR 46) (Protection of Human Subjects)	HHS (Office for Human Research Protections – OHRP)	IRB; informed consent; vulnerable populations
Animal Welfare Act (7 USC 2131 et seq.)	USDA (Animal and Plant Health Inspection Service – APHIS)	Care and use of animals (excludes rats, mice, birds)
Public Health Service Policy on Humane Care and Use of Laboratory Animals	NIH (Office of Laboratory Animal Welfare – OLAW)	Care and use of vertebrates (includes rats, mice, birds; covers all PHS-funded research)

5. Quick Revision Checklist for Exams

Biosafety

Risk Groups (RG1-RG4; examples: RG2: S. aureus, HBV; RG3: M. tuberculosis, B. anthracis; RG4: Ebola, Marburg)
Biosafety Levels (BSL-1 to BSL-4): practices, safety equipment, facility features
Primary containment (BSCs – Class I, II, III) vs. secondary containment (facility design)
PPE: lab coat, gloves, N95, PAPR, positive pressure suit
Decontamination: autoclaving (121°C, 15 psi, 15-20 min), bleach (0.5-10%), ethanol (70%)
Good Microbiological Practices (hand washing; no mouth pipetting; sharps precautions)

Biosecurity

Biosecurity definition: protect from theft, misuse, intentional release
Select Agents (Tier 1: Ebola, Marburg, smallpox, B. anthracis, Y. pestis, botulinum toxin)
Dual-Use Research of Concern (DURC): 7 experimental categories
Biorisk management (CWA 15793): risk assessment → mitigation → monitoring → improvement

Bioethics

Four principles: autonomy, beneficence, non-maleficence, justice
Informed consent: information disclosure, comprehension, voluntariness, competence
IRB: reviews human subjects research (exempt, expedited, full board)
Vulnerable populations: children, prisoners, pregnant women, cognitively impaired
3Rs: Replacement, Reduction, Refinement (animal research)
IACUC: animal research oversight
Key issues: gene editing (CRISPR; germline vs. somatic); cloning (reproductive vs. therapeutic); stem cells (ESC vs. iPSC); genetic testing; synthetic biology

BTH-3121: Bioinformatics – Comprehensive Study Notes

Bioinformatics is an interdisciplinary field that develops methods and software tools for understanding biological data. These notes cover the fundamental concepts, databases, algorithms, and computational techniques used to analyze DNA, RNA, protein sequences, and structures. The content is designed for students in biotechnology, biology, and computational biology programs.

Part 1: Foundations of Bioinformatics

1.1 What is Bioinformatics?

Bioinformatics is the application of computational, mathematical, and statistical techniques to solve biological problems. It is often defined as the “science of information” as applied to biology. The field emerged from the need to manage, analyze, and interpret the vast amounts of data generated by genome sequencing projects. The primary goal of this course is to enable students to use computational tools to analyze complex biological data and solve real-world problems.

Key Insight: Bioinformatics is not just about using software; it’s about understanding the biological question, selecting the appropriate tool, correctly interpreting the output, and recognizing the limitations of computational methods.

1.2 The Scope of Bioinformatics

Based on course syllabi (e.g., BTH-3121), the core areas of bioinformatics include :

Domain	Focus
Sequence Analysis	Pairwise and multiple sequence alignment, database searching (BLAST)
Genomics	Genome sequencing, assembly, annotation, comparative genomics
Transcriptomics	RNA-seq analysis, gene expression profiling
Structural Bioinformatics	Protein structure prediction, visualization, molecular docking
Phylogenetics	Evolutionary tree reconstruction
Systems Biology	Protein-protein interaction networks, metabolic pathways
Computational Biology	Algorithm development, mathematical modeling of biological systems

1.3 The Central Role of Biological Databases

The explosion of biological data has made databases a cornerstone of modern bioinformatics. Databases are structured, searchable collections of biological information.

Database Category	Purpose	Examples
Primary Databases	Store raw, unannotated sequence data	GenBank (NCBI), ENA (EBI), DDBJ
Secondary (Derived) Databases	Contain curated, annotated, and processed information	UniProtKB/Swiss-Prot, RefSeq, Pfam
Specialized Databases	Focus on a specific organism, data type, or disease	TAIR (Arabidopsis), miRBase (microRNAs), OMIM (genetic disorders)
Structural Databases	Store 3D structures of biological macromolecules	Protein Data Bank (PDB)

Part 2: Biological Databases and Sequence File Formats

2.1 Major Sequence Repositories (The “Big Three”)

The International Nucleotide Sequence Database Collaboration (INSDC) is a foundational framework for bioinformatics. It consists of three primary databases that share data daily:

Database	Location	Access	Key Features
GenBank	NCBI (USA)	https://www.ncbi.nlm.nih.gov/genbank/	Most widely used; includes all publicly available DNA sequences
ENA	EBI (UK)	https://www.ebi.ac.uk/ena	Comprehensive European resource
DDBJ	Japan	https://www.ddbj.nig.ac.jp	Major Asian repository

2.2 The Protein Data Bank (PDB)

The PDB (https://www.rcsb.org) is the single worldwide repository for 3D structural data of biological macromolecules (proteins, DNA, RNA). Each structure has a unique 4-character alphanumeric accession code (e.g., 1TUP for triosephosphate isomerase).

Key information in a PDB file:

Atomic coordinates (x, y, z positions of every atom)
Secondary structure assignment
Experimental method (X-ray crystallography, NMR, Cryo-EM)
Resolution (for X-ray structures; lower is better)
Ligand and cofactor information

2.3 UniProtKB – Protein Knowledgebase

UniProtKB is the central resource for protein sequence and functional information. It has two main sections:

Section	Features	Curation Level
Swiss-Prot	Manually annotated, reviewed entries. High quality, extensive cross-references, literature citations.	High (human-curated)
TrEMBL	Automatically annotated, unreviewed entries. High volume, but may contain errors.	Low (computationally generated)

2.4 Sequence File Formats

Understanding file formats is essential for working with bioinformatics software.

A. FASTA Format (Simple Sequence Storage)

Text-based format for representing nucleotide or protein sequences.
Structure:
- Line 1: > (greater-than symbol) followed by a unique sequence identifier and optional description.
- Following lines: The sequence itself (letters A, T, G, C for DNA; single-letter amino acid codes for proteins).
- Lines can be wrapped at a fixed width (e.g., 80 characters) but this is not mandatory.

Example:

>NP_001311194.1 triosephosphate isomerase [Homo sapiens]
MAPKFFVGNSNVNMLKSLADFKKHTGEDFKKVASGEDKISILGNG

B. GenBank (GBK) Format (Rich Annotated Sequences)

A detailed, structured text format that stores the sequence and extensive annotations (e.g., gene locations, CDS features, source organism, authors, journal reference).
Far more comprehensive than FASTA but also larger and more complex to parse.

C. FASTQ Format (Sequencing Reads + Quality Scores)

Standard format for storing high-throughput sequencing reads (e.g., from Illumina).
Structure (4 lines per read):
1. @ followed by sequence identifier.
2. The nucleotide sequence (e.g., AAGCATGCA).
3. + (optional additional identifier).
4. Quality scores for each base, encoded as ASCII characters. Higher ASCII code → higher confidence.

Part 3: Sequence Alignment

Sequence alignment is the heart of bioinformatics. It involves arranging two or more sequences to identify regions of similarity.

3.1 Types of Sequence Alignment

Type	Description	Use Case
Pairwise Alignment	Compares two sequences to find the optimal match.	Finding similar sequences in a database, comparing a query to a known gene.
Multiple Sequence Alignment (MSA)	Aligns three or more sequences simultaneously.	Identifying conserved regions, building phylogenetic trees, protein domain analysis.
Global Alignment	Aligns sequences from end to end (entire length).	Comparing two sequences of similar length and high overall similarity.
Local Alignment	Finds regions of local similarity within potentially very different sequences.	Identifying conserved domains within a protein, searching databases for fragments similar to a query.

3.2 Pairwise Alignment Algorithms

A. Dot Plot

A visual method for comparing two sequences.
A grid is drawn, with one sequence on the x-axis and the other on the y-axis.
A dot is placed where the characters match.
Diagonal lines of dots indicate regions of similarity. Breaks in the diagonal indicate gaps.

B. Needleman-Wunsch (Global Alignment)

Purpose: Finds the optimal alignment that includes both sequences from beginning to end.
Method: Dynamic programming algorithm.
Scoring: Uses a scoring matrix (e.g., match = +1, mismatch = -1) and a gap penalty.
Output: The single best global alignment.

C. Smith-Waterman (Local Alignment)

Purpose: Finds the optimal alignment of the most similar local region, ignoring the rest of the sequences.
Method: Dynamic programming with a key difference: the algorithm can reset the score to zero, preventing negative scores from extending the alignment.
Output: The best local alignment.

D. Heuristic Methods (e.g., BLAST, FASTA)

Purpose: Very fast, approximate database searching. Not guaranteed to find the optimal alignment.
Method: Uses word-matching to find “seeds” (short, perfect matches) and then extends them to generate alignments. This is much faster than rigorous Smith-Waterman.
Use Case: Searching a query sequence against a massive database like GenBank.

3.3 Multiple Sequence Alignment (MSA) Methods

Method	Description	Software Examples
Progressive Alignment	Builds the alignment step-by-step, following a guide tree. Aligns the most similar sequences first, then adds more distant ones.	ClustalW, Clustal Omega, MUSCLE
Iterative Methods	Refines an initial alignment by repeatedly realigning subgroups.	MUSCLE, MAFFT (MAFFT also uses progressive/iterative strategies)
Consistency-Based	Uses information from alignments of all triplets of sequences to guide the MSA.	T-Coffee
Hidden Markov Model (HMM)	Uses probabilistic models (HMMs) to represent a family of sequences and align new members to the model.	HMMER (for profile HMMs), SAM

3.4 Scoring Matrices

Scoring matrices assign a numerical score for aligning any two characters. They are critical for assessing the quality of an alignment.

A. Substitution Matrices (for amino acids)

Based on the observed frequency of one amino acid being substituted by another in evolutionarily related proteins.
PAM (Point Accepted Mutation): Based on small, closely related sequences. PAM1 represents 1% divergence.
BLOSUM (BLOcks SUbstitution Matrix): Based on conserved, ungapped regions of distantly related proteins. BLOSUM62 (the number is the % identity of the sequences used) is the default for most BLAST searches.
- Rule of thumb: For closely related sequences, use a high-number PAM or a low-number BLOSUM? Conversely, for distantly related sequences, use a low-number PAM or a high-number BLOSUM? It is important to match the matrix to the expected divergence.

B. Scoring Guidelines

Match (Diagonal) Scores: Positive (e.g., BLOSUM62: +1 to +11).
Conservative Substitutions: Positive but low (e.g., Valine (V) to Isoleucine (I)).
Non-conservative Substitutions: Negative (e.g., Valine (V) to Arginine (R)).
Gap Penalties: Always negative. An affine gap penalty (gap opening penalty + gap extension penalty) is standard (e.g., -11 for opening, -1 for extension).

3.5 BLAST (Basic Local Alignment Search Tool)

BLAST is the most widely used bioinformatics tool. It finds regions of local similarity between biological sequences.

The BLAST Algorithm Steps:

Word Generation: The query sequence is broken into short “words” (e.g., 3 aa for proteins, 11 nt for DNA).
Seed Finding: The algorithm scans the database for exact matches to these words (seeds).
Extension: The seed is extended in both directions using a substitution matrix (for proteins) until the alignment score drops below a threshold.
Evaluation: The statistical significance of the alignment is calculated (E-value).

Key BLAST Programs:

Program	Query	Target Database	Use Case
blastn	Nucleotide	Nucleotide	Find similar DNA sequences
blastp	Protein	Protein	Find homologous proteins
blastx	Nucleotide (translated in 6 frames)	Protein	Find potential protein-coding regions in a DNA sequence
tblastn	Protein	Nucleotide (translated in 6 frames)	Find DNA that might encode a protein similar to the query
tblastx	Nucleotide (translated)	Nucleotide (translated)	Find possible homology between two DNA sequences at the protein level

Understanding BLAST Output:

Max Score: The highest alignment score (bit-score) from any hit; higher is better.
Total Score: Sum of scores from all alignments (only if there are multiple high-scoring pairs).
Query Cover: Percentage of the query sequence that is aligned to the hit.
E-value (Expectation value): The number of times you would expect to find a match of this quality (or better) purely by chance in a database of that size. The lower the E-value, the more significant the hit (e.g., E = 1e-50 is excellent; E = 0.05 is probably not significant).

Part 4: Phylogenetic Analysis

Phylogenetics is the study of evolutionary relationships among groups of organisms (or genes).

4.1 Key Concepts

Term	Definition
Phylogenetic Tree	A diagram representing evolutionary relationships.
Node	Represents a common ancestor (branching point).
Branch (Edge)	Represents a lineage (a population through time).
Root	The most recent common ancestor of all taxa in the tree.
Clade	A group consisting of a common ancestor and all its descendants (a monophyletic group).
Homology	Similarity due to shared ancestry.
Homoplasy	Similarity due to convergent evolution, not shared ancestry.

4.2 Types of Phylogenetic Trees

Feature	Rooted Tree	Unrooted Tree
Direction of Evolution	Shows the direction of evolutionary change (from root to branches).	Does not show the direction of evolution.
Key Information	Reveals which groups are most ancient.	Only displays relationships (which taxa are more closely related).
Outgroup	A known distant relative is needed to “root” the tree.	No outgroup is required.

4.3 Tree Building Methods

Method	Description	Pros	Cons
Distance-Based (e.g., Neighbor-Joining, NJ)	Calculates a pairwise distance matrix, then clusters the closest sequences.	Very fast, can handle large datasets.	Loses information (sequence details are reduced to a single number).
Maximum Parsimony (MP)	Seeks the tree that requires the fewest evolutionary changes (mutations).	Intuitive; explicit model of evolution not required.	Can be fooled by homoplasy (convergent evolution). Very slow for many taxa.
Maximum Likelihood (ML)	Finds the tree that maximizes the probability of observing the given data under a specific evolutionary model.	Statistically rigorous, uses full sequence information.	Very slow, computationally intensive.
Bayesian Inference (BI)	Similar to ML, but incorporates prior probabilities and uses Markov Chain Monte Carlo (MCMC) to sample trees.	Provides a probability distribution of trees; can incorporate complex models.	Very slow, computationally intensive; influenced by prior assumptions.

4.4 Tree Assessment: Bootstrapping

Bootstrap analysis is a statistical method used to assess the confidence of the branches (clades) in a phylogenetic tree.

Procedure:

Randomly sample columns (with replacement) from the original multiple sequence alignment to create a “pseudo-replicate” dataset of the same size.
Build a new tree from this pseudo-replicate.
Repeat this process many times (e.g., 100, 1000 times).
The bootstrap value at a node is the percentage of these replicate trees that contain that same clade.

Interpretation:

High Bootstrap Value (e.g., >90%): Strong statistical support for that branch.
Low Bootstrap Value (e.g., <70%): Little confidence; the relationship is not well-resolved.

Part 5: Genomics

Genomics is the study of the complete set of genetic material (the genome) of an organism.

5.1 Genome Sequencing

Method	Description	Read Length	Accuracy	Cost per Genome (approx.)
Sanger Sequencing	Chain-termination method (dideoxynucleotides).	600-1000 bp	Very High (~99.99%)	High
Illumina (NGS)	Sequencing by synthesis; massively parallel.	150-300 bp	High (~99.9%)	Low
PacBio (SMRT)	Real-time sequencing of a single DNA molecule.	10,000 – 50,000+ bp	Lower (~90%) with single pass; high with circular consensus	Medium
Oxford Nanopore	Measures changes in electrical current as DNA passes through a nanopore.	Very long (>100,000 bp)	Lower (~92-95%)	Low

5.2 Genome Assembly

Genome assembly is the process of taking many short DNA sequencing reads and reconstructing the original genome.

Reads: Raw sequencing fragments.
Contigs: Longer, contiguous sequences formed by overlapping reads.
Scaffolds: Contigs linked together by paired-end read information, but with some gaps (represented by ‘N’s).

5.3 Genome Annotation

Genome annotation is the process of identifying functional elements (genes, regulatory regions) within a genome sequence.

Steps:

Gene Prediction (Ab initio): Using computational algorithms to find Open Reading Frames (ORFs), splice sites, and promoter sequences.
Homology-based Prediction: Using BLAST to find similar, known genes from other organisms.
Functional Annotation: Assigning a putative function to the predicted gene product using tools like InterProScan (for protein domains) and Gene Ontology (GO) terms.
Structural Annotation: Defining the boundaries of genes, exons, introns, and other features.

Gene Ontology (GO): A standardized vocabulary for describing gene functions across three domains:

Cellular Component: Where the gene product is located (e.g., nucleus, cytoplasm, mitochondria).
Molecular Function: What the gene product does (e.g., kinase activity, DNA binding).
Biological Process: The broader process the gene is involved in (e.g., cell cycle, immune response).

5.4 Transcriptomics (RNA-seq)

Transcriptomics is the study of all RNA transcripts (the transcriptome) produced by a cell.

Typical RNA-seq Analysis Pipeline:

Read Alignment: Align the sequencing reads to a reference genome (e.g., using STAR, HISAT2).
Quantification: Count the number of reads mapping to each gene (e.g., using featureCounts).
Normalization: Adjust counts to account for sequencing depth and transcript length (e.g., TPM, RPKM, DESeq2’s median-of-ratios).
Differential Expression (DE) Analysis: Statistically compare gene expression levels between two conditions (e.g., healthy vs. diseased) to identify which genes are significantly up- or down-regulated (e.g., using DESeq2, edgeR).
Visualization:
- Volcano Plot: Shows log₂(fold change) vs. -log₁₀(p-value). Points in the top-left and top-right corners are significantly differentially expressed.
- Heatmap: Clusters samples and genes by expression level (a color-coded matrix).

Part 6: Structural Bioinformatics

Structural bioinformatics focuses on the prediction and analysis of the 3D structure of biological macromolecules.

6.1 Protein Structure Visualization

Tools like PyMOL, ChimeraX, and the web-based PDBsum are used to view and analyze PDB files.

Common Visualizations:

Ribbon diagram: Shows the secondary structure (α-helices as spirals, β-strands as arrows).
Space-filling model: Shows the van der Waals surface of the molecule (provides a sense of shape and size).
Surface representation: Shows the accessible surface area, often colored by property (e.g., hydrophobicity, electrostatic potential).

6.2 Protein Structure Prediction

When no experimental structure is available, computational methods can predict a protein’s 3D structure from its amino acid sequence.

Method	Description	Key Tools
Homology (Comparative) Modeling	Builds a model using a known structure (template) of a homologous protein. The most accurate method when a good template exists.	SWISS-MODEL, Modeller
Threading (Fold Recognition)	Folds the sequence into a known structural fold library. Used when no close homolog is found.	Phyre2 (also uses homology), I-TASSER
Ab initio (De novo) Modeling	Predicts structure from first principles, using only the laws of physics and chemistry. Used when no similar structure is known.	I-TASSER, Rosetta

AlphaFold2 (and AlphaFold3): A revolutionary deep learning method from DeepMind. It achieves near-experimental accuracy for many single-domain proteins, outperforming traditional methods for most targets.

6.3 Molecular Docking

Molecular docking is a computational method that predicts the preferred orientation and binding affinity of one molecule (a ligand) to another (a receptor) when they form a stable complex.

Applications:

Drug discovery: Screening large libraries of small molecules to find potential drug candidates that bind to a target protein.
Protein-protein interaction studies: Understanding how two proteins interact.
Active site identification: Docking a known ligand can help locate the binding site.

Example Workflow (using AutoDock Vina):

Prepare receptor (protein) structure (remove water, add hydrogens, assign charges).
Prepare ligand (small molecule) structure (generate 3D coordinates, assign charges).
Define a “grid box” (search space) around the predicted binding site.
Run docking algorithm, which explores different orientations (poses) of the ligand.
Score the poses using a scoring function (e.g., binding affinity in kcal/mol). The most negative score is the best predicted binding mode.

Part 7: Systems Biology and Networks

Systems biology is the computational and mathematical modeling of complex biological systems (e.g., metabolic pathways, signaling cascades, gene regulatory networks).

7.1 Protein-Protein Interaction (PPI) Networks

Nodes: Represent proteins.
Edges: Represent physical or functional interactions (e.g., two proteins that bind together).

Properties of PPI Networks:

Scale-free: A few proteins (hubs) have many interactions, while most have few.
Small-world: Any two proteins can be connected through a short path.

Databases: STRING (search tool for recurring instances of neighbouring genes), BioGRID.

7.2 Metabolic Pathway Analysis

Metabolic pathways are series of chemical reactions in a cell, catalyzed by enzymes, that convert substrates into products.
KEGG (Kyoto Encyclopedia of Genes and Genomes) is the primary database for mapping genes to pathways.

Pathway Enrichment Analysis:
Given a list of differentially expressed genes (from an RNA-seq experiment), you can ask: Which biological pathways are overrepresented in this list?

Example (using DAVID or clusterProfiler):

Input: List of 500 up-regulated genes.
Output: “GO:0006094 (gluconeogenesis)” is enriched (p-value = 1e-10). This suggests the cell is activating gluconeogenesis under the experimental condition.

Part 8: Key Terms and Concepts (Glossary)

Term	Definition
GenBank	The primary nucleotide sequence database at NCBI (USA).
FASTA	A simple, widely used text-based format for representing nucleotide or protein sequences.
BLAST	The Basic Local Alignment Search Tool; used to find regions of local similarity between sequences.
E-value	In BLAST, the expected number of times a hit of this quality would occur by chance. Lower is better.
Needleman-Wunsch	A dynamic programming algorithm for global sequence alignment.
Smith-Waterman	A dynamic programming algorithm for local sequence alignment.
BLOSUM62	A default amino acid substitution matrix used in BLASTp for aligning proteins of moderate divergence.
Phylogenetic Tree	A diagram representing the evolutionary relationships among a group of organisms or genes.
Bootstrapping	A statistical resampling method used to assess the confidence of branches in a phylogenetic tree.
Genome Assembly	The process of reconstructing a genome from overlapping sequencing reads.
Gene Ontology (GO)	A standardized vocabulary for describing the cellular component, molecular function, and biological process of gene products.
RNA-seq	High-throughput sequencing of RNA; used to measure gene expression levels.
Molecular Docking	A computational method that predicts the preferred orientation and binding energy of a ligand when bound to a receptor.
PDB (Protein Data Bank)	The single global repository for 3D structural data of proteins, DNA, and RNA.
AlphaFold	An AI system developed by DeepMind that predicts protein structures with high accuracy.
KEGG (Kyoto Encyclopedia of Genes and Genomes)	A database resource for understanding high-level functions and utilities of biological systems, especially metabolic pathways.
Contig	A contiguous sequence of DNA assembled from overlapping sequencing reads.
Scaffold	A set of contigs linked together by paired-end reads, often containing gaps represented by ‘N’s.
Volcano Plot	A type of scatter plot used to visualize differential expression results (p-value vs. fold-change).
Heatmap	A graphical representation of data where individual values are represented as colors; used to cluster genes or samples by expression.

Summary Table: Bioinformatics Tools at a Glance

Task	Recommended Tool(s)	Key Consideration
Database Searching (Nucleotide)	BLASTn (NCBI)	Use megablast for nearly identical sequences.
Database Searching (Protein)	BLASTp (NCBI)	BLOSUM62 is default; choose a different matrix for very close/distant relations.
Multiple Sequence Alignment	Clustal Omega, MUSCLE, MAFFT, T-Coffee	MUSCLE/MAFFT are fastest; T-Coffee is most accurate but slower.
Phylogenetic Tree	MEGA (GUI), IQ-TREE (command line), RAxML	Maximum Likelihood is the standard for publication-quality trees.
RNA-seq Analysis	STAR/HISAT2 → featureCounts → DESeq2	A complex, multi-step pipeline. Many steps require command-line expertise.
Protein Structure Prediction	SWISS-MODEL (homology), AlphaFold Colab (high accuracy)	Use SWISS-MODEL if a good template exists; AlphaFold for difficult cases.
Gene Function Annotation	BLAST2GO, InterProScan, DAVID	InterProScan is best for protein domains; DAVID for pathway enrichment.
Molecular Docking	AutoDock Vina, CB-Dock2 (web)	Define an accurate binding site (grid box) for reliable results.
Visualization (Structures)	PyMOL, ChimeraX	PyMOL is a standard; ChimeraX has excellent new features.
Visualization (Data)	R (ggplot2), Python (matplotlib/seaborn)	Essential skills for creating publication-quality figures.

Exam Preparation Questions

Short Answer Questions

What is the difference between a primary and a secondary (derived) biological database? Give one example of each.
You have sequenced a gene from a new species and want to know what protein it might encode. Which BLAST program would you use and why?
Explain the difference between global and local sequence alignment. Give a scenario where a local alignment would be more useful than a global alignment.
What does a high bootstrap value (e.g., 95%) on a phylogenetic tree indicate? What does a low bootstrap value (e.g., 45%) indicate?
What is the difference between a contig and a scaffold in genome assembly?
What information does a “volcano plot” convey in an RNA-seq experiment? What do the points in the top-left and top-right corners represent?
What is the basic premise of molecular docking? Name one important application.

Long Answer Questions

Describe the BLAST algorithm step-by-step. Use a diagram if helpful. What is the meaning of the “E-value” and “bitscore” in the output?
You are analyzing a set of protein sequences. Walk through the process of performing a phylogenetic analysis, starting from the sequences and ending with a rooted, bootstrapped tree.
Explain the workflow of a typical RNA-seq experiment for differential gene expression, from raw sequencing reads to a list of significantly up- and down-regulated genes. Name a tool for each major step.
Compare and contrast three different methods for protein structure prediction: homology modeling, threading, and ab initio. When would you choose each method?
You suspect a protein might be a kinase. How would you use bioinformatics tools to support or refute this hypothesis? Outline a step-by-step approach, including the specific databases and tools you would use.

Study Tip: The most effective way to learn bioinformatics is to do bioinformatics. Set up an account on the NCBI website. Try running a few BLAST searches. Download a PDB structure and open it in PyMOL (which is free for academic use). Follow a tutorial for SWISS-MODEL to build a homology model. This hands-on experience will solidify the theoretical concepts covered in these notes far more effectively than passive reading. Practice with the command line; many powerful bioinformatics tools (like DESeq2, IQ-TREE) have no graphical interface. Even basic familiarity with Linux will dramatically increase your capabilities in this field.

BTH-3131 Agriculture Biotechnology – Study Notes

1. Core Concepts & Scope

Agricultural Biotechnology: The application of scientific techniques to modify plants, animals, and microorganisms for agricultural purposes. It encompasses genetic engineering, molecular markers, tissue culture, and bioinformatics to improve crop yield, quality, stress tolerance, and resistance to pests and diseases .
Key Distinction: Traditional breeding relies on crossing sexually compatible plants and selecting desirable traits over many generations. Agricultural biotechnology uses direct manipulation of DNA to introduce specific traits, often from unrelated species, in a much shorter timeframe .
Why It Matters:
- Food Security: Addresses challenges of growing global population (projected 9.7 billion by 2050) and climate change.
- Reduced Inputs: Develop crops requiring less water, fertilizer, and pesticide.
- Nutritional Enhancement: Biofortification to address micronutrient deficiencies (Vitamin A, iron, zinc).

Major Areas of Agricultural Biotechnology

Area	Description	Examples
Genetic Engineering (GE) / Transgenic Technology	Introduction of foreign genes (transgenes) into plant genomes.	Bt cotton (insect resistance), Roundup Ready® soybeans (herbicide tolerance), Golden Rice (β-carotene enrichment)
Molecular Marker-Assisted Selection (MAS)	Use of DNA markers linked to desirable traits to select plants without phenotype screening.	Selection of disease resistance genes in wheat, rice, and maize
Tissue Culture (Micropropagation)	Aseptic cultivation of plant cells, tissues, or organs for rapid clonal propagation, virus elimination, and germplasm conservation.	Banana and potato multiplication; orchid propagation
Genome Editing (CRISPR/Cas9)	Precise modification of specific DNA sequences without introduction of foreign DNA (transgene-free).	Disease-resistant rice (e.g., Xa13 promoter editing for bacterial blight resistance)
Biofertilizers & Biopesticides	Use of beneficial microorganisms to enhance nutrient availability or control pests.	Rhizobium (nitrogen fixation), Bacillus thuringiensis (Bt biopesticide), Trichoderma (fungal biocontrol)
Bioinformatics & Genomics	Computational analysis of genomic data to identify genes and pathways for crop improvement.	Identification of drought-responsive genes; genome-wide association studies (GWAS)

2. Plant Tissue Culture (Micropropagation)

Plant tissue culture is the foundation of many plant biotechnology applications, providing sterile explants for genetic transformation and rapid clonal propagation.

2.1 Fundamental Principles

Totipotency: The ability of a single plant cell (or small group of cells) to regenerate into a whole, fertile plant. This is the fundamental basis for plant tissue culture .
Aseptic Technique: All cultures must be sterile (free from bacteria, fungi) to prevent contamination.

2.2 Stages of Micropropagation (Murashige, 1974)

Stage	Name	Objective	Key Treatments
Stage 0	Pre-culture / Mother plant selection	Select healthy, disease-free donor plant	Ensure explant quality
Stage I	Establishment (Initiation)	Establish aseptic culture; surface sterilization	High auxin? Not usually; basal MS medium
Stage II	Multiplication	Produce large number of shoots (axillary branching)	Cytokinin (BAP 1-3 mg/L); subculture every 3-6 weeks
Stage III	Rooting (Pre-transplant)	Induce roots on microshoots	Auxin (NAA, IBA); reduced cytokinin
Stage IV	Acclimatization (Hardening)	Transfer to greenhouse/field; transition from heterotrophic to autotrophic	High humidity → gradual decrease

2.3 Explant Types and Applications

Explant	Culture Type	Application
Meristem (shoot tip)	Shoot tip culture	Virus elimination (meristems lack vascular connections); clonal propagation
Leaf disc	Callus induction → organogenesis	Genetic transformation (e.g., Agrobacterium-mediated)
Anther / Microspore	Anther culture	Haploid plant production → Doubled haploid (DH) for homozygous lines (accelerated breeding)
Immature embryo	Embryo culture	Rescue of hybrid embryos (wide crosses); overcome seed dormancy
Protoplast	Protoplast culture	Somatic hybridization (protoplast fusion); direct gene uptake

2.4 Plant Growth Regulators (PGRs) in Tissue Culture

The balance between auxins and cytokinins determines the morphogenic pathway:

Auxin:Cytokinin Ratio	Morphogenic Response
High auxin / low cytokinin	Root formation
Low auxin / high cytokinin	Shoot formation
Intermediate auxin / intermediate cytokinin	Callus proliferation
High 2,4-D (auxin) followed by auxin-free	Somatic embryogenesis

PGR	Abbreviation	Function
2,4-Dichlorophenoxyacetic acid	2,4-D	Callus induction; somatic embryogenesis
Naphthaleneacetic acid	NAA	Root induction
Indole-3-butyric acid	IBA	Root induction (especially woody species)
6-Benzylaminopurine	BAP (BA)	Shoot multiplication (most common cytokinin)
Thidiazuron	TDZ	Potent cytokinin for woody species and recalcitrant plants
Gibberellic acid	GA₃	Shoot elongation; seed germination

3. Genetic Engineering of Plants (Transgenic Technology)

3.1 Methods of Gene Transfer

Method	Principle	Advantages	Disadvantages
Agrobacterium tumefaciens	Natural genetic engineer; transfers T-DNA (Ti plasmid) into plant genome; integrates stably	Low copy number; stable integration; large fragments; widely applicable (dicots)	Poor transformation of monocots (improved with super-virulent strains)
Biolistics (Particle Bombardment, Gene Gun)	High velocity microprojectiles (gold/tungsten particles) coated with DNA penetrate cells	Works on any plant species (including monocots, chloroplasts); no host specificity	Multiple, sometimes complex integration patterns; DNA rearrangement possible
Polyethylene Glycol (PEG)-mediated	Chemical treatment of protoplasts with PEG induces DNA uptake	Simple; inexpensive; direct gene transfer	Requires protoplasts (requires cell wall removal, regeneration variable)
Electroporation	Electrical pulses create temporary pores in membrane; DNA enters	Efficient for protoplasts and some intact tissues (e.g., immature embryos)	Requires protoplasts or specific tissues

3.2 Selectable Markers and Reporter Genes

Marker	Selective Agent	Mechanism	Use
nptII (neomycin phosphotransferase II)	Kanamycin, Geneticin (G418)	Inactivates aminoglycoside antibiotics	Most common selectable marker in plant transformation
hpt (hygromycin phosphotransferase)	Hygromycin B	Inactivates hygromycin	Alternative to kanamycin; effective in many species
bar (phosphinothricin acetyltransferase)	Glufosinate ammonium (PPT), Basta	Acetylates and detoxifies PPT (herbicide)	Herbicide resistance marker; selection on PPT
GUS (β-glucuronidase)	– (requires substrate X-Gluc)	Produces blue color where expressed	Reporter gene (not selective)
GFP (Green Fluorescent Protein)	– (requires UV or blue light)	Fluoresces green	Reporter gene; non-destructive; real-time visualization

3.3 Important Transgenic Crops and Traits

Trait	Gene(s)	Gene Source	Crops	Benefit
Insect resistance (Bt)	cry genes (e.g., cry1Ab, cry1Ac, cry2Ab)	Bacillus thuringiensis (soil bacterium)	Cotton, maize, soybean, brinjal (eggplant)	Reduced insecticide use; control of bollworm, corn borer
Herbicide tolerance (Glyphosate)	cp4 epsps (5-enolpyruvylshikimate-3-phosphate synthase)	Agrobacterium sp. strain CP4	Soybean, maize, canola, cotton, sugar beet	Allows post-emergence glyphosate application; weed control without crop damage
Herbicide tolerance (Glufosinate)	bar (phosphinothricin acetyltransferase)	Streptomyces hygroscopicus	Canola, maize, soybean, rice	Tolerance to glufosinate (Basta) herbicide
Virus resistance (Papaya)	Coat protein gene (CP)	Papaya ringspot virus (PRSV)	Papaya	Rescue of Hawaiian papaya industry from PRSV (Rainbow, SunUp varieties)
Biofortification (Golden Rice)	psy (phytoene synthase) + crtI (phytoene desaturase)	Daffodil (Narcissus) + bacterium (Pantoea ananatis)	Rice	Produces β-carotene (pro-Vitamin A) to address Vitamin A deficiency (VAD)
Drought tolerance	cspB (cold shock protein)	Bacillus subtilis	Maize (MON 87460)	Enhanced yield under water-limited conditions
Delayed ripening (Flavr Savr tomato)	Antisense PG (polygalacturonase) gene	Tomato (antisense construct)	Tomato	Extended shelf life; reduced softening

3.4 Regulation of Genetically Modified (GM) Crops

Biosafety: Assessment of potential risks to human health and the environment before release .
Cartagena Protocol on Biosafety (2000): International agreement governing the transboundary movement of Living Modified Organisms (LMOs).
Labeling requirements: Vary by country (mandatory in EU, China, Japan; voluntary in US).
Regulatory Bodies (by country): USDA APHIS, EPA, FDA (US); EFSA (EU); Genetic Engineering Appraisal Committee (GEAC, India); National Biosafety Committee (Pakistan).

4. Molecular Markers and Marker-Assisted Selection (MAS)

Molecular markers are DNA sequences associated with specific genes or traits, used to accelerate plant breeding.

4.1 Types of Molecular Markers (Increasing in resolution)

Marker Type	Description	Advantages	Disadvantages	Cost
RFLP (Restriction Fragment Length Polymorphism)	Southern blotting; restriction enzyme digestion	Co-dominant; highly reproducible	Laborious; requires large DNA; radioactive probes	High (historical)
RAPD (Random Amplified Polymorphic DNA)	Arbitrary 10-mer primers; PCR-based	Simple; fast; no sequence info needed	Dominant; poor reproducibility	Low
AFLP (Amplified Fragment Length Polymorphism)	Restriction + selective PCR amplification	High multiplex ratio; reproducible	Dominant; technically demanding	Moderate
SSR (Simple Sequence Repeat, Microsatellite)	PCR with flanking primers; repeat motif (e.g., CACACA)	Co-dominant; highly reproducible; abundant	Requires sequence knowledge for primer design; development cost	Moderate
SNP (Single Nucleotide Polymorphism)	Single base pair differences; high-throughput arrays or sequencing	Abundant; co-dominant; automatable; genome-wide coverage	Requires genomic resources; bioinformatics	Low (now)

4.2 Applications of MAS

Application	Description	Example
Marker-assisted backcrossing (MABC)	Accelerate introgression of a target gene into an elite variety	Introgressing submergence tolerance (Sub1) into popular rice varieties (Swarna-Sub1)
Gene pyramiding	Stacking multiple resistance genes into a single variety	Pyramiding bacterial blight resistance genes (Xa4, xa5, xa13, Xa21) in rice
Selection of recessive traits	MAS can select homozygous recessive plants even without phenotype expression (in early generations)	Selecting disease resistance (often recessive) before phenotype can be assessed
Foreground vs. Background selection	Foreground = selecting target gene; Background = selecting for recovery of recurrent parent genome	MABC for any trait

5. Genome Editing (CRISPR/Cas9)

Genome editing allows precise modification of specific DNA sequences without the introduction of foreign DNA from other species (transgene-free in final product).

5.1 Mechanism of CRISPR/Cas9

sgRNA (single guide RNA) + Cas9 (nuclease)
         ↓
sgRNA binds to complementary DNA sequence (target)
         ↓
Cas9 creates double-strand break (DSB) at target site
         ↓
Cellular repair pathways: NHEJ (non-homologous end joining) → gene knockout (mutations)
                     or HDR (homology-directed repair) → gene knock-in (using donor template)

5.2 Applications in Agriculture

Application	Example	Outcome
Disease resistance	Editing Xa13 promoter in rice (disrupts TAL effector binding of Xanthomonas oryzae)	Bacterial blight resistance (transgene-free)
Herbicide tolerance	Editing ALS (acetolactate synthase) gene	Tolerance to sulfonylurea herbicides
Improved quality	Editing GBSS (granule-bound starch synthase) in potato	High amylopectin (waxy) starch
Reduced allergens	Editing TdLTP (lipid transfer protein)	Reduced allergenicity in wheat
Drought tolerance	Editing OsNAC transcription factors	Enhanced drought tolerance

5.3 Regulatory Status of Genome-Edited Crops

Region	Regulatory Approach	Key Point
United States	Regulated on a case-by-case basis; if transgene-free, may not be regulated as GMO	USDA APHIS exempts certain edits (no foreign DNA, no pest risk)
European Union	Regulated as GMO (European Court of Justice ruling, 2018)	Most restrictive; genome-edited crops treated same as transgenic
Japan	Not regulated as GMO if no foreign DNA remains	Approved several genome-edited crops (tomato, fish)
Argentina, Brazil, Canada	Product-based regulation; transgene-free not regulated as GMO	Most permissive; includes many genome-edited products
China	Developing guidelines; investments in gene editing research	Likely to adopt product-based approach

6. Biofertilizers and Biopesticides

6.1 Biofertilizers

Microorganism	Mechanism	Target Crop / Application	Benefit
Rhizobium (symbiotic)	Nitrogen fixation in root nodules	Legumes (soybean, pea, chickpea, alfalfa)	Reduces need for synthetic nitrogen fertilizer
Azospirillum	Nitrogen fixation (associative; root surface)	Cereals (maize, wheat, rice)	Improved growth and yield
Azotobacter	Free-living nitrogen fixation	Non-leguminous crops (cotton, vegetables)	Enhanced nitrogen availability
Phosphate-solubilizing bacteria (PSB) (e.g., Bacillus, Pseudomonas)	Solubilize inorganic phosphate (P) by organic acid production	Most crops	Increases available P from insoluble soil phosphates
Arbuscular mycorrhizal fungi (AMF)	Symbiotic with roots; extends hyphal network	Most crops (except Brassicaceae, Chenopodiaceae)	Enhances P, water, and micronutrient uptake

6.2 Biopesticides

Microorganism / Product	Target Pests	Mode of Action
Bacillus thuringiensis (Bt)	Lepidopteran caterpillars, some beetles, Diptera	Cry toxin crystals; alkaline gut activates toxin → pore formation → death
Trichoderma (fungus)	Fungal pathogens (e.g., Rhizoctonia, Pythium, Fusarium)	Mycoparasitism; antibiotic production; competition for space
Bacillus subtilis	Fungal and bacterial pathogens	Antibiotic production (iturins, surfactins); competition
Beauveria bassiana (entomopathogenic fungus)	Insect pests (aphids, whiteflies, thrips, beetles)	Spores penetrate insect cuticle; produces toxins
Nuclear polyhedrosis virus (NPV)	Specific insect larvae (e.g., Spodoptera)	Viral infection; occlusion bodies ingested → systemic infection

7. Applications of Biotechnology in Agriculture

7.1 Abiotic Stress Tolerance

Stress	Mechanisms	Transgenic Examples
Drought	Osmotic adjustment (proline, trehalose, glycine betaine); late embryogenesis abundant (LEA) proteins; transcription factors (DREB, NAC)	cspB (maize, MON 87460); OsDREB1A (rice)
Salinity	Ion homeostasis (Na⁺ exclusion, compartmentalization); osmolyte synthesis; antioxidant enzymes	AtNHX1 (Na⁺/H⁺ antiporter) in tomato; codA (choline oxidase) in rice
Flooding / Submergence	Ethylene response; energy conservation; anaerobic respiration	Sub1 gene (rice, from FR13A); introgressed into elite varieties via MAS
Extreme temperature (heat/cold)	Chaperone proteins (HSPs); membrane lipid modification; antifreeze proteins (AFPs)	CBF/DREB1 (cold tolerance); HSP overexpression

7.2 Biotic Stress Resistance

Pathogen/Pest	Resistance Genes/Markers	Crops
Bacterial blight (Xanthomonas oryzae pv. oryzae)	Xa21, xa5, xa13, Xa4 (MAS pyramided)	Rice
Fungal rust (Puccinia spp.)	Lr (leaf rust), Sr (stem rust), Yr (stripe rust) genes (MAS)	Wheat
Fusarium wilt	I, I-1, I-2 (MAS)	Tomato, cotton, banana
Late blight (Phytophthora infestans)	Rpi resistance genes from wild relatives (cisgenesis, MAS)	Potato
Insects (Lepidoptera, Coleoptera)	cry genes (Bt)	Cotton, maize, brinjal (eggplant)

7.3 Nutritional Enhancement (Biofortification)

Crop	Target Nutrient	Gene(s) / Approach	Status
Golden Rice (GR2)	β-carotene (pro-Vitamin A)	psy (maize) + crtI (bacterium)	Approved in Philippines (2021); Bangladesh under review
High-iron rice	Iron (Fe)	Ferritin (soybean) + NAS (nicotianamine synthase)	Field trials completed
High-zinc wheat	Zinc (Zn)	Increased expression of zinc transporters	Commercial varieties released (Australia, India)
Lysine-rich maize	Lysine (essential amino acid)	CordapA (modified DHPS enzyme) + cDHDPS	Quality Protein Maize (QPM; conventional breeding + MAS)
Purple/anthocyanin-rich tomato	Anthocyanins (antioxidants)	Transcription factors (Del, Ros1) from snapdragon	Commercialized (Purple Tomato, Norfolk Healthy Produce)

8. Socio-economic and Ethical Considerations

8.1 Concerns and Debates

Issue	Proponents’ View	Opponents’ View
Safety	GM crops extensively tested (20+ years, no documented health harm)	Long-term effects unknown; allergenicity potential
Environmental impact	Reduced pesticide use; conservation tillage; lower carbon footprint	Gene flow to wild relatives; development of resistant pests/weeds; impact on non-target organisms
Intellectual property (IP)	Patents encourage innovation and investment	Corporate control of seed supply; farmers cannot save seeds (terminator technology is not used commercially)
Labeling	Consumers have right to know	Labeling implies risk; increases costs without benefit
Smallholder farmers	Can benefit from higher yields and lower inputs	High seed cost; dependence on multinational corporations

8.2 Global Status of GM Crops (ISAAA Briefs)

Leading GM crops: Soybean, maize, cotton, canola (also alfalfa, sugar beet, potato, papaya, squash, brinjal)
Top countries: USA, Brazil, Argentina, India, Canada
Stacked traits: Multiple genes (e.g., Bt + herbicide tolerance) are increasingly common
Golden Rice: First approval (Philippines, 2021) – landmark for nutritionally enhanced GM crop

9. Important Terms and Definitions

Term	Definition
Transgene	A gene introduced from one organism into the genome of another (often from different species).
Cisgene	A gene introduced from a sexually compatible (same species) or closely related species.
Intragenic	A modified gene containing only DNA sequences from the same species (no foreign DNA).
GMO (Genetically Modified Organism)	An organism whose genome has been altered by genetic engineering (broad term).
Transgenic plant	A plant containing a transgene.
Event	A specific insertion of a transgene into a plant genome (unique location).
Regeneration	The process of growing a whole plant from a single cell or explant in tissue culture.
Somatic embryogenesis	Development of embryos from somatic (non-reproductive) cells.
Somaclonal variation	Genetic or epigenetic variation arising from tissue culture (can be problematic or useful).
Backcrossing	Crossing of a hybrid with one of its parents (usually the recurrent parent, elite variety).
Introgression	Transfer of a gene from one variety into the genetic background of another via backcrossing.
Gene stacking (pyramiding)	Combining multiple genes (e.g., resistance genes) into a single variety.
Off-target effect (CRISPR)	Unintended modification at non-target genomic sites with sequence similarity.
Gene drive	Genetic element that biases inheritance to spread rapidly through populations (controversial).
Biosafety	Assessment and management of potential risks associated with genetic modification.
Co-existence	Ability of farmers to grow GM, conventional, and organic crops together.

10. Exam Tips

Mnemonics

Tissue Culture Stages: “Every Mother Raises Amazing Babies” – Establishment (I), Multiplication (II), Rooting (III), Acclimatization (IV) – plus Stage 0 (Pre-culture). (Adjust: I, II, III, IV = Establish, Multiply, Root, Acclimate.)
Selectable Markers (4 common): “Nice Hot Boiled Gator” – NptII (kanamycin), Hpt (hygromycin), Bar (Basta), GUS (reporter, not selective). (For selective: nptII, hpt, bar, and pat – omit GUS.)
Bt Gene Family: “Cry1Ab, Cry1Ac, Cry2Ab” – “Cry…”. Bt = Bacillus thuringiensis; Cry = crystal protein.
Marker Types (order of development): “RAPD, RFLP, AFLP, SSR, SNP” – RAPD, RFLP, AFLP, SSR, SNP – in order of increasing resolution.
CRISPR Repair Pathways: “NHEJ = Nasty cuts (knockout); HDR = Handy Donor Repair (knock-in).”

Common Pitfalls

Mistake	Correction
Confusing auxin and cytokinin roles	Auxin = roots; Cytokinin = shoots (but balance matters).
Assuming all GM crops are Bt	GM crops include herbicide tolerance, virus resistance, drought tolerance, nutritional enhancement, and many other traits.
Thinking genome editing always creates GMOs	Transgene-free edits (small deletions, single base changes) are not regulated as GMOs in many countries (US, Japan, Argentina).
Believing marker-assisted selection is genetic engineering	MAS uses DNA markers to select natural variation (no gene transfer). MAS is an advanced breeding tool, not biotechnology in the regulatory sense.
Forgetting that plant tissue culture is required for Agrobacterium transformation	Most transformation protocols require a regeneration step from explants (leaf discs, callus) via tissue culture.
Overlooking the difference between micropropagation and genetic engineering	Micropropagation is clonal multiplication of existing plants (no gene change). Genetic engineering introduces new genes.

BTH-3152: Genomics & Proteomics – Comprehensive Study Notes

These notes provide a detailed analysis of genomics and proteomics, covering the fundamental concepts, technologies, and applications of high‑throughput analysis of genomes and proteomes. They are designed for undergraduate and graduate students in biotechnology, molecular biology, genetics, and bioinformatics.

Part A: Foundations of Genomics

Unit 1: Introduction to Genomics

1.1 Definition and Scope

Genomics is the study of the structure, function, evolution, and mapping of genomes. A genome is the complete set of DNA (or RNA in some viruses) of an organism, including all of its genes and non‑coding sequences.

Evolution of Genomics:

Era	Key Technologies	Major Achievements
Genetics (1900s‑1970s)	Breeding, mutagenesis	Mendelian inheritance; linkage maps; one gene‑one enzyme hypothesis.
Molecular Biology (1970s‑1990s)	Recombinant DNA, Sanger sequencing.	Restriction maps; cloning; first recombinant DNA; early genome sequences (phage, virus).
Genomics (1990s‑2000s)	High‑throughput sequencing (capillary electrophoresis).	Human Genome Project (2001 draft, 2003 complete). Genomes of many model organisms (E. coli, yeast, worm, fly, mouse).
Functional Genomics (2000s‑present)	Microarrays, next‑generation sequencing (NGS).	Transcriptomes (RNA‑seq); ChIP‑seq (protein‑DNA interactions); epigenomics.
Comparative & Evolutionary Genomics (2000s‑present)	Genome sequencing of multiple species.	Identification of conserved non‑coding elements; evolutionary constraint.

1.2 Genome Organization

Genome Size	Organism	Number of Genes	Features
4.6 Mb	Escherichia coli	~4,300	Circular chromosome; operons; little non‑coding DNA.
12 Mb	Saccharomyces cerevisiae (yeast).	~6,000	Linear chromosomes; some introns; compact.
100 Mb	Arabidopsis thaliana (plant).	~27,000	Polyploid history; many repeats.
180 Mb	Drosophila melanogaster (fly).	~14,000	Chromosomes; heterochromatin.
3,000 Mb	Homo sapiens (human).	~20,000‑25,000	Many repeats; introns (~95% of gene transcribed region is intronic).
130,000 Mb	Paris japonica (plant, largest known).	Unknown	Mostly repetitive DNA.

C‑Value Paradox: Lack of correlation between genome size and organismal complexity (due to non‑coding and repetitive DNA content).

1.3 Structure of the Human Genome

Coding DNA (~1.5% of genome) : Exons, splice sites.
Non‑coding DNA (~98.5% of genome) :
- Regulatory elements: Promoters, enhancers, silencers, insulators.
- Non‑coding RNA genes: rRNA, tRNA, snRNA, snoRNA, miRNA, lncRNA.
- Introns: Intervening sequences within genes.
- Repetitive DNA (~50% of genome) :
  - Tandem repeats: Satellite DNA, minisatellites, microsatellites (simple sequence repeats – SSRs).
  - Interspersed repeats: Transposable elements (LINEs, SINEs, LTR retrotransposons, DNA transposons).

Unit 2: Genome Sequencing Technologies

2.1 First‑Generation Sequencing (Sanger)

Principle: Chain termination using dideoxynucleotides (ddNTPs) labeled with fluorescent dyes.

Workflow:

Template DNA (single‑stranded) + primer + DNA polymerase + dNTPs + ddNTPs (four separate reactions or single reaction with dye‑labeled ddNTPs).
Capillary electrophoresis (size separation).
Laser excitation; fluorescence detection.

Read length: 500‑1,000 bp.

Advantages: High accuracy (>99.99%), long reads (by 1st gen standards).

Disadvantages: Low throughput, high cost per base, not scalable for large genomes (human genome project cost ~$3 billion).

2.2 Next‑Generation Sequencing (NGS)

Platform	Principle	Read Length	Throughput	Error Rate	Features
Illumina (Solexa).	Sequencing by synthesis (SBS); reversible terminators (4 fluorescently labeled nucleotides).	50‑300 bp (paired‑end).	Very high (up to 6 Tb per run).	0.1‑1% (substitutions).	Dominant platform; high accuracy; low cost per base; short reads.
Ion Torrent	Semiconductor sequencing; H⁺ released during nucleotide incorporation changes pH.	200‑400 bp.	Moderate.	1% (indels common).	Fast run time; no optics; homopolymer errors.
454 (Roche – discontinued)	Pyrosequencing (light emitted when nucleotide incorporated).	400‑700 bp.	Low.	1% (indels).	Longer reads than Illumina; discontinued.

2.3 Third‑Generation Sequencing (Long‑Read)

Platform	Principle	Read Length	Throughput	Error Rate	Features
PacBio (Single Molecule Real‑Time – SMRT).	Zero‑mode waveguides detect nucleotide incorporation in real time (phospholinked fluorescent nucleotides).	10‑50 kb (average).	Moderate.	10‑15% (random, mainly indels).	Long reads; high consensus accuracy (>99.9% with circular consensus – CCS); resolves repeats.
Oxford Nanopore (ONT).	Protein nanopore in membrane; ionic current changes as DNA passes through; current signal decoded to base sequence.	10 kb – 1 Mb (ultra‑long).	Moderate to High.	5‑15% (random; improving with newer flow cells and basecalling models).	Ultra‑long reads (Mb); direct RNA sequencing; real‑time analysis; portable (MinION).

Long‑read advantages:

Span repetitive regions (telomeres, centromeres, segmental duplications).
Resolve structural variants (insertions, deletions, inversions, translocations).
Phase haplotypes (determine which variants are on same chromosome).
De novo genome assembly with fewer gaps.

Unit 3: Genome Assembly and Annotation

3.1 Genome Assembly

Definition: Reconstruction of the original genome sequence from short sequencing reads.

Assembly Algorithms:

Algorithm	Principle	Best for	Limitations
Overlap‑Layout‑Consensus (OLC)	Builds overlap graph (pairwise alignments); simplifies graph; extracts consensus.	Long reads (Sanger, PacBio, Nanopore).	Computationally intensive; not suitable for millions of short reads.
De Bruijn Graph	Splits reads into k‑mers; builds graph (nodes = k‑mers, edges = k‑mer adjacency).	Short reads (Illumina).	Sensitive to k‑mer size; misses repeats longer than k‑1.

Assembly Strategies:

Assembly Type	Description	Applications
De Novo Assembly	Assemble genome without a reference.	New species; no close reference available; detect novel sequence.
Reference‑Guided Assembly	Map reads to a reference genome; resolve variants.	Resequencing (mutation detection, SNP calling).

Hybrid Assembly (short reads + long reads): Use long reads for scaffolding and gap‑filling; short reads for error correction.

Assembly Quality Metrics:

Metric	Definition	Interpretation
N50	Length of the shortest contig such that contigs of this length or longer cover 50% of the assembly.	Larger N50 indicates more contiguous assembly.
L50	Number of contigs whose lengths sum to at least 50% of the assembly.	Smaller L50 is better.
BUSCO (Benchmarking Universal Single‑Copy Orthologs).	Percentage of conserved single‑copy orthologs present in assembly.	High completeness (>95%) indicates near‑complete genome.
QV (Quality Value)	Phred‑scaled error rate (e.g., QV40 = 99.99% base accuracy).	Accuracy of consensus sequence.

3.2 Genome Annotation

Definition: Identifying and labeling all features (genes, non‑coding RNAs, repeats, regulatory elements) in a genome.

Types of Annotation:

Type	Description	Methods
Structural Annotation	Locating genes (exons, introns, start/stop codons, splice sites).	Ab initio prediction (AUGUSTUS, GENSCAN, Glimmer); homology‑based (BLAST against known proteins); transcript‑based (RNA‑seq alignments with StringTie, Cufflinks).
Functional Annotation	Assigning function to gene products.	Homology (BLAST against Swiss‑Prot, TrEMBL, KEGG); domain analysis (InterProScan, Pfam); pathway mapping (KEGG, Reactome).
Comparative Annotation	Transferring annotations from well‑annotated reference species (liftOver, UCSC).	Works well for closely related species.

Gene Prediction in Prokaryotes: Operons; no introns (continuous coding). Tools: Prodigal, Glimmer.

Gene Prediction in Eukaryotes: Complex with introns and exons; require evidence (transcript alignments, protein homology, ab initio predictions combined with MAKER, BRAKER).

Unit 4: Functional Genomics

4.1 Transcriptomics (RNA‑seq)

Definition: High‑throughput sequencing of RNA to measure gene expression levels and identify transcripts (including novel splice variants, non‑coding RNAs).

RNA‑seq Workflow:

RNA isolation (total RNA or enriched mRNA (polyA+) or depleted rRNA).
Fragment RNA (or cDNA).
Reverse transcription to cDNA.
Adapter ligation.
Library amplification (PCR).
Sequencing (Illumina, long‑read direct RNA‑seq with Nanopore).
Data analysis (alignment, quantification, differential expression).

Data Analysis Pipeline:

Step	Software	Output
Quality control	FastQC, multiQC.	Quality metrics (per‑base quality, GC content, adapter contamination).
Trimming	Trimmomatic, cutadapt.	Clean reads (remove adapters, low‑quality bases).
Alignment	STAR, HISAT2, minimap2.	SAM/BAM files (alignment positions).
Quantification	featureCounts, HTSeq‑count, RSEM.	Count matrix (genes × samples).
Differential Expression	DESeq2, edgeR, limma‑voom.	List of differentially expressed genes (log₂ fold change, adjusted p‑value).

Applications:

Compare gene expression between conditions (disease vs. healthy, treatment vs. control).
Identify alternative splicing events.
Detect novel transcripts and fusion genes (cancer).
Quantify allele‑specific expression.

Single‑Cell RNA‑seq (scRNA‑seq) : Transcriptomes of individual cells; reveals cellular heterogeneity (tissue composition, rare cell types, developmental trajectories). Technologies: Drop‑seq, 10x Genomics Chromium, SMART‑seq2.

4.2 Epigenomics

Definition: Study of heritable changes in gene expression that do not involve changes in DNA sequence.

Key Techniques:

Technique	Target	Principle	Applications
ChIP‑seq (Chromatin Immunoprecipitation + sequencing).	Protein‑DNA interactions (histone modifications, transcription factors).	Crosslink protein to DNA; immunoprecipitate with specific antibody; sequence bound DNA.	Map histone marks (H3K4me3 – active promoters, H3K27me3 – Polycomb repression, H3K36me3 – transcribed regions, H3K9me3 – heterochromatin). Map transcription factor binding sites (TFBS).
ATAC‑seq (Assay for Transposase‑Accessible Chromatin).	Open chromatin regions (accessible to Tn5 transposase).	Hyperactive Tn5 transposase inserts adapters into accessible regions.	Identify regulatory elements (promoters, enhancers) without antibody.
BS‑seq (Bisulfite Sequencing).	DNA methylation (5‑methylcytosine – 5mC).	Bisulfite converts unmethylated C to U (sequenced as T); methylated C remains C.	Whole‑genome methylation maps; methylation‑sensitive regions.
Hi‑C (High‑throughput chromosome conformation capture).	3D chromatin architecture.	Crosslink chromatin; proximity ligation of interacting DNA fragments; sequencing.	Topologically associating domains (TADs); enhancer‑promoter loops.

Part B: Foundations of Proteomics

Unit 5: Introduction to Proteomics

5.1 Definition and Scope

Proteomics is the large‑scale study of the proteome – the entire set of proteins produced or modified by an organism at a given time under specific conditions.

Distinction from Genomics:

Aspect	Genomics	Proteomics
Target	DNA (static).	Proteins (dynamic).
Information	Potential (genes present).	Actual (expressed, post‑translationally modified).
Variation	Sequence changes (alleles).	Splicing, PTMs, degradation.
Quantification	Limited to copy number (mRNA abundance).	Direct protein abundance (dynamic range >10⁶).
Technologies	Sequencing, microarrays.	Mass spectrometry (MS), protein arrays, Edman degradation.

5.2 The Proteomics Workflow

Sample (cells, tissue, biofluid)
       ↓
Protein extraction & solubilization
       ↓
Protein separation (SDS‑PAGE, LC)
       ↓
Proteolytic digestion (trypsin)
       ↓
Peptide separation (LC)
       ↓
Mass spectrometry (MS1)
       ↓
Fragmentation (MS2)
       ↓
Data analysis (database search)
       ↓
Protein identification & quantification

Unit 6: Protein Separation Techniques

6.1 Gel‑Based Separation

Technique	Separation Basis	Applications
SDS‑PAGE	Molecular weight (denatured).	Protein purity; molecular weight estimation (using standards).
Native PAGE	Native charge and size (native conformation).	Activity assays; protein complexes.
Isoelectric Focusing (IEF)	Isoelectric point (pI).	Protein pI determination.
2D‑PAGE (IEF + SDS‑PAGE).	pI (first dimension) → molecular weight (second dimension).	High‑resolution separation; differential expression (difference gel electrophoresis – DIGE).

Limitations: Poor resolution for low abundance or membrane proteins; labour‑intensive; limited dynamic range.

6.2 Liquid Chromatography (LC)

Reversed‑Phase (RP) HPLC (C18 column, water/acetonitrile gradient): Most common for LC‑MS/MS. Separates peptides by hydrophobicity.

Other LC Modes:

Ion exchange (IEX) : Charge‑based separation.
Size exclusion (SEC) : Size‑based separation (native proteins).
Hydrophilic interaction (HILIC) : For polar analytes (glycopeptides, phosphopeptides).

Multidimensional Protein Identification Technology (MudPIT) : 2D LC (SCX (strong cation exchange) + RP) online with MS; suitable for complex samples without prior gel separation.

Unit 7: Mass Spectrometry for Proteomics

7.1 Ionization Sources

Source	Principle	Features	Applications
Electrospray Ionization (ESI)	High voltage (2‑6 kV) on liquid sample; desolvation produces multiply charged ions.	Soft; multiply charged ions (z = 1‑50+); LC‑MS compatible.	Peptides, proteins, small molecules; bottom‑up proteomics (LC‑ESI‑MS/MS).
Matrix‑Assisted Laser Desorption/Ionization (MALDI)	Sample co‑crystallized with matrix; laser desorption/ionization.	Soft; predominantly singly charged ions; spot‑based.	Peptide mass fingerprinting; tissue imaging (MALDI‑imaging).

7.2 Mass Analyzers

Analyzer	Principle	Resolution	Mass Accuracy	Features
Quadrupole	RF/DC filtering; only ions of selected m/z pass.	Low (unit resolution).	100‑500 ppm.	Inexpensive; robust; MS/MS (triple quad).
Time‑of‑Flight (TOF)	Ions accelerate to same kinetic energy; drift time √(m/z).	Moderate to High (10,000‑50,000).	5‑20 ppm.	High mass range; MALDI‑TOF; LC‑TOF.
Orbitrap	Electrostatic trapping; oscillation frequency m/z‑dependent.	Very High (100,000‑1,000,000).	< 1‑3 ppm.	High resolution, accurate mass (HRAM). Dominant in proteomics (Thermo).
Ion Trap (3D, linear).	RF trapping; sequential ejection.	Moderate (up to 10,000).	50‑100 ppm.	MSⁿ (multi‑stage); CID.
FT‑ICR	Cyclotron frequency in magnetic field ∝ 1/(m/z).	Ultra‑High (1,000,000+).	< 0.5 ppm.	Highest resolution; expensive; slow scanning.

7.3 Tandem MS (MS/MS) for Protein Identification

Bottom‑Up Proteomics Workflow (most common):

Digest protein (trypsin → peptides).
LC separation.
MS¹ (MS1) : Measure intact peptide masses (precursor ions).
Select precursor (data‑dependent acquisition – DDA).
Fragmentation (collision‑induced dissociation – CID, higher‑energy collisional dissociation – HCD, electron transfer dissociation – ETD).
MS² (MS2) : Measure fragment ion masses.
Database search: Compare observed fragment masses against theoretical masses from in silico digestion of protein database (FASTA). Search engines: SEQUEST, Mascot, Andromeda (MaxQuant), MS‑Fragger.

Peptide Identification:

Score (e.g., XCorr, Mascot ion score): Measures match quality between observed and theoretical spectrum.
False Discovery Rate (FDR) : Controls for random matches (decoy database search). Target‑decoy approach: accept peptides at specified FDR (e.g., 1% peptide‑level FDR, 1% protein‑level FDR).

Protein Inference (parsimony principle): Minimal set of proteins that explains all identified peptides.

Unit 8: Quantitative Proteomics

8.1 Label‑Based Quantification

Method	Principle	Multiplexing	Features
SILAC (Stable Isotope Labeling by Amino acids in Cell culture).	Metabolic labeling with heavy (¹³C, ¹⁵N) and light amino acids (Lys, Arg).	2‑3 conditions.	Accurate; in vivo; no chemical derivatization; requires culturing.
Tandem Mass Tags (TMT)	Chemical labeling of peptides (amine reactive, isobaric tags).	Up to 18‑plex.	Multiplexing; suitable for any sample type; requires MS2‑based quantification (higher accuracy with MS3 – SPS‑MS3).
iTRAQ (Isobaric Tags for Relative and Absolute Quantitation).	Chemical labeling (similar to TMT).	4‑plex or 8‑plex.	Similar to TMT.
Dimethyl labeling	Chemical labeling (formaldehyde + cyanoborohydride).	2‑3 conditions.	Inexpensive; simple.

Quantification in MS2 (or MS3) : Intensities of reporter ions (TMT, iTRAQ) or peak areas of light vs. heavy peptides (SILAC, dimethyl).

8.2 Label‑Free Quantification (LFQ)

Method	Principle	Applications
Area Under Curve (AUC)	Integrates precursor ion peak area across runs (requires alignment).	Large‑scale proteomics (e.g., MaxLFQ in MaxQuant).
Spectral Counting	Counts number of MS/MS spectra assigned to each protein.	Semi‑quantitative; simple; lower accuracy than intensity‑based.

Advantages of LFQ: No labeling, unlimited number of conditions, no chemical modification, works with any sample type.

Disadvantages: Run‑to‑run variation requires careful alignment and normalization.

Unit 9: Post‑Translational Modifications (PTMs)

PTM	Residue(s)	Mass Shift (Da)	Identification
Phosphorylation	Ser, Thr, Tyr	+79.966	Enrichment (TiO₂, IMAC); MS2 (neutral loss of H₃PO₄) or ETD (preserves labile PTM).
Glycosylation	Asn (N‑linked), Ser/Thr (O‑linked).	Variable (HexNAc = 203.079, Hex = 162.052).	Enrichment (lectin affinity, HILIC); ETD for glycan retention.
Ubiquitination	Lys	+114.043 (Gly‑Gly remnant).	Enrichment (antibody against di‑Gly remnant); ETD.
Acetylation	Lys (N‑terminal).	+42.011	Affinity enrichment (antibody).
Methylation	Lys, Arg	+14.016 (mono), +28.031 (di), +42.047 (tri).	Methyl‑specific antibodies (some).

Enrichment strategies:

Phosphopeptides: TiO₂ (titanium dioxide), IMAC (immobilized metal affinity chromatography – Fe³⁺, Ga³⁺).
Glycopeptides: Lectin affinity (Con A, WGA), HILIC (hydrophilic interaction liquid chromatography).
Ubiquitination: Anti‑di‑Gly antibody (K‑ε‑GG enrichment).
Acetylation: Anti‑acetyl‑lysine antibody.

Unit 10: Proteomics Applications

Application	Description	Techniques
Protein Identification	Identify proteins in complex mixtures (cell lysate, IP eluate, gel band).	LC‑MS/MS; database search (Mascot, SEQUEST).
Differential Expression	Compare protein abundance between conditions (disease vs. healthy, treated vs. control).	SILAC, TMT, LFQ (MaxQuant, Proteome Discoverer).
Protein‑Protein Interactions (PPI)	Identify interactors of a bait protein.	Affinity purification‑MS (AP‑MS); co‑IP followed by MS.
Post‑Translational Modification (PTM) Mapping	Identify modified residues (phosphorylation, glycosylation, ubiquitination).	Enrichment + LC‑MS/MS; PTM‑specific search (e.g., MaxQuant PTM scoring, Mascot delta score).
Clinical Proteomics	Discover biomarkers in biofluids (serum, urine, CSF).	LC‑MS/MS; targeted proteomics (PRM, MRM).
Top‑Down Proteomics	Analyze intact proteins (not digested).	High‑resolution MS (Orbitrap, FT‑ICR); ETD fragmentation.

Sample Exam Questions

Define genomics and proteomics. Explain the C‑value paradox. Why does genome size not correlate with organismal complexity?
Describe the principle of Illumina (SBS) sequencing. What are the advantages and limitations of short‑read sequencing compared to long‑read sequencing (PacBio, Oxford Nanopore)?
A researcher has sequenced the genome of a new bacterial species. Explain the steps involved in genome assembly (de novo) and annotation (structural and functional).
Calculate the N50 for the following set of contig lengths: 100, 200, 300, 400, 500. Show your work. What does N50 indicate about assembly quality?
What is the difference between bottom‑up and top‑down proteomics? Which is more commonly used and why?
Explain the principles of electrospray ionization (ESI) and MALDI. Which ionization method is better suited for LC‑MS coupling?
A protein is digested with trypsin, and the resulting peptides are analyzed by LC‑MS/MS. How does the mass spectrometer identify the protein? Describe the role of database searching and false discovery rate (FDR) estimation.
Compare SILAC, TMT, and label‑free quantification (LFQ). Which method allows multiplexing of up to 18 samples? Which method does not require any chemical or metabolic labeling?
Describe the steps of RNA‑seq (transcriptomics) analysis, from RNA isolation to differential expression. What is the purpose of aligning reads to a reference genome or transcriptome?
Explain the principle of ChIP‑seq. How is it used to map histone modifications (e.g., H3K4me3, H3K27me3) across the genome? What biological information do these marks provide?

Let me know if you need:

Detailed experimental protocols (RNA‑seq library prep, ChIP‑seq, SILAC, TMT, LC‑MS/MS).
Bioinformatics pipelines (Galaxy, Nextflow, Snakemake) with step‑by‑step instructions.
Data analysis tutorials (DESeq2, edgeR, MaxQuant, Proteome Discoverer, Mascot, Sequest, MS‑Fragger).
Case studies (cancer genomics, microbiome metagenomics, proteomics of neurodegenerative diseases, biomarker discovery).
Comparative tables of NGS platforms, mass analyzers, quantification methods, and PTM enrichment strategies.

Good luck with your Genomics & Prote

BTH-3162 Food Biotechnology (Detailed Study Notes)

📖 Course Overview

Food Biotechnology is the application of biological and engineering principles to the processing, production, and preservation of food. This field integrates microbiology, biochemistry, genetics, and bioprocess engineering to improve food quality, safety, nutrition, and sustainability .

Course Code: BTH-3162
Credit Hours: 3(2-1)

Course Objectives:

Understand the role of microorganisms in food production and preservation
Learn modern biotechnological tools for food processing
Explore emerging technologies (precision fermentation, genetic modification, nanobiotechnology)
Evaluate safety, regulatory, and ethical aspects of food biotechnology

Part 1: Foundations of Food Biotechnology

1.1 Definition and Scope

Food Biotechnology encompasses the use of living organisms (microorganisms, plants, animals) or their components to develop or modify food products. Traditional applications include fermentation (bread, cheese, yogurt, beer), while modern applications include genetic modification, enzyme technology, and cellular agriculture .

Key Areas of Food Biotechnology:

Area	Description	Examples
Traditional Fermentation	Using microorganisms to transform food	Yogurt, cheese, bread, beer, wine
Enzyme Technology	Using purified enzymes for food processing	Rennet for cheese, amylases for syrups
Genetic Modification	Altering genetic material of food organisms	Bt corn, Golden Rice, GM soybeans
Precision Fermentation	Engineering microbes to produce specific food components	Animal-free dairy proteins, heme for plant-based meat
Nanobiotechnology	Using nanoparticles for food applications	Nanoencapsulation, nanosensors
Biomass Fermentation	Using microbial cells as protein source	Mycoprotein (Quorn)

1.2 Historical Development

Period	Milestone	Significance
~7000 BCE	Beer and bread production	First intentional use of fermentation
~6000 BCE	Wine production	Yeast-based fermentation
~3000 BCE	Cheese making	Bacterial fermentation
1857	Pasteur’s work on fermentation	Demonstrated microbial role in fermentation
1890s	Enzymes in food processing	First commercial enzymes
1970s	Immobilized enzymes	High-fructose corn syrup production
1982	First GM food product (human insulin via E. coli)	Not food, but proof of concept
1994	Flavr Savr tomato	First whole GM food
2000s	Genetically modified crops widely adopted	Soy, corn, canola
2020s	Precision fermented proteins	Animal-free dairy, egg, meat analogues

1.3 Major Microorganisms in Food Biotechnology

Bacteria:

Species	Applications	Key Products
Lactococcus lactis	Dairy fermentation	Cheese, buttermilk
Lactobacillus spp.	Yogurt, probiotics, sourdough	Lactic acid, bacteriocins
Streptococcus thermophilus	Yogurt, cheese	Lactic acid
Bacillus subtilis	Enzyme production	Proteases, amylases
Acetobacter spp.	Vinegar production	Acetic acid
Escherichia coli (engineered)	Enzyme and protein production	Rennet, insulin

Yeasts:

Species	Applications	Key Products
Saccharomyces cerevisiae	Baking, brewing, wine, bioethanol	CO₂, ethanol, flavor compounds
Komagataella phaffii (Pichia pastoris)	Protein expression	Recombinant proteins
Kluyveromyces lactis	Cheese making	Lactase, rennet

Filamentous Fungi:

Species	Applications	Key Products
Aspergillus niger	Enzyme production	Citric acid, glucoamylase
Aspergillus oryzae	Soy sauce, sake	Proteases, amylases
Fusarium venenatum	Mycoprotein production	Quorn (meat analogue)
Trichoderma reesei	Enzyme production	Cellulases

Part 2: Traditional and Industrial Fermentation

2.1 Principles of Food Fermentation

Definition: Fermentation is a metabolic process where microorganisms convert organic substrates (sugars) into simpler compounds, producing energy and metabolic byproducts (acids, alcohols, gases).

Types of Fermentation:

Type	Microorganism	End Products	Food Examples
Lactic acid fermentation	LAB (Lactobacillus, Lactococcus)	Lactic acid, CO₂	Yogurt, cheese, sauerkraut, kimchi
Alcoholic fermentation	Yeasts (S. cerevisiae)	Ethanol, CO₂	Beer, wine, bread
Acetic acid fermentation	Acetobacter	Acetic acid	Vinegar
Propionic acid fermentation	Propionibacterium	Propionic acid, CO₂	Swiss cheese
Alkaline fermentation	Bacillus spp.	Ammonia	Natto, dawadawa

2.2 Major Fermented Foods

Dairy Fermentation:

Product	Microorganisms	Fermentation Process	Key Characteristics
Yogurt	S. thermophilus + L. bulgaricus	Co-fermentation; lactic acid production	Thick texture, tangy flavor
Cheese	Various LAB + rennet	Coagulation + fermentation	Hundreds of varieties
Buttermilk	L. lactis, L. cremoris	Lactic acid fermentation	Tangy, thick liquid
Kefir	LAB + yeasts (symbiotic culture)	Mixed fermentation	Slightly effervescent, probiotic
Sour cream	LAB	Lactic acid fermentation	Thick, tangy

Plant-based Fermentation:

Product	Substrate	Microorganisms	Process
Sauerkraut	Cabbage	LAB (natural)	Salt fermentation
Kimchi	Cabbage, radish, seasonings	LAB, various	Salt + spice fermentation
Pickles	Cucumbers	LAB	Brine fermentation
Miso	Soybeans, rice	A. oryzae + LAB + yeast	Koji fermentation
Tempeh	Soybeans	Rhizopus oligosporus	Solid-state fungal fermentation
Natto	Soybeans	B. subtilis	Alkaline fermentation

2.3 Fermentation Systems

Solid-State Fermentation (SSF):

Microorganisms grow on solid substrate with low moisture
Used for: Koji (soy sauce, miso), tempeh, fungal enzymes
Advantages: Low water usage, high product concentration
Disadvantages: Difficult to control parameters

Submerged Fermentation (SmF):

Microorganisms grow in liquid medium
Used for: Most industrial enzymes, antibiotics, yeast biomass
Advantages: Easy to control, higher yields
Disadvantages: Higher water usage, downstream processing costs

2.4 Postbiotics and Bioactive Metabolites

Definition: Postbiotics are bioactive compounds (organic acids, bacteriocins, enzymes, peptides) produced by probiotic microorganisms during fermentation .

Postbiotic	Source Microorganism	Function
Lactic acid	LAB	pH reduction, antimicrobial
Bacteriocins (nisin)	L. lactis	Antibacterial (food preservative)
Hydrogen peroxide	LAB	Antimicrobial
Exopolysaccharides	Various LAB	Texture improvement, prebiotic
Short-chain fatty acids	Various	Gut health

Application Example: Cell-free supernatant (CFS) from L. lactis incorporated into edible coatings extended ostrich meat shelf life by reducing microbial growth and lipid oxidation .

Part 3: Precision Fermentation

3.1 Definition and Principles

Precision Fermentation (PF) is a technology that uses genetically modified microorganisms (GMMs) to produce specific functional components (proteins, enzymes, lipids, flavors) that are traditionally derived from animals or plants .

Key Distinctions:

Type	Process	Example
Traditional Fermentation	Whole microorganisms transform substrate	Yogurt, bread, beer
Biomass Fermentation	Microorganisms themselves are the product	Quorn (mycoprotein), nutritional yeast
Precision Fermentation	Microorganisms produce specific compounds	Animal-free casein, whey, heme, collagen

3.2 The Precision Fermentation Process

The technical production of precision-fermented foods involves several key stages :

Microbial Host Selection → Genetic Design → Upstream Processing → Downstream Purification → Final Product

Stage 1: Microbial Host Selection
Selecting an appropriate host is critical and involves multiple criteria :

Criterion	Considerations	Example Hosts
Safety status	GRAS/QPS designation preferred	S. cerevisiae (GRAS), E. coli K-12
Post-translational modifications	Required for complex proteins	K. phaffii (yeast) for mammalian proteins
Secretion capability	Reduces downstream processing	A. niger secretes enzymes efficiently
Growth rate	Faster = lower production cost	E. coli (fast); fungi (slower)
Substrate flexibility	Use of inexpensive feedstocks	Y. lipolytica (hydrophobic substrates)

Common Host Organisms for Precision Fermentation :

Host	Advantages	Limitations	Common Products
Saccharomyces cerevisiae	GRAS, well-studied, genetic tools	Lower yields for some proteins	Recombinant enzymes, flavors
Komagataella phaffii	High protein secretion, eukaryotic PTMs	Less genetic toolkit	Animal-free dairy proteins
Aspergillus niger	Excellent secretion, GRAS	Slow growth	Industrial enzymes
Escherichia coli	Fast growth, extensive toolkit	No PTMs, endotoxin risk	Simple proteins, enzymes
Yarrowia lipolytica	Hydrophobic substrate use	Less characterized	Lipids, organic acids

Stage 2: Genetic Design and Engineering

Target gene (encoding desired protein) inserted into host genome
Promoters, terminators, and selection markers added
CRISPR/Cas9 commonly used for precise genome editing
Multiple gene copies may be integrated to increase yield

Stage 3: Upstream Processing

Media formulation: Defined or complex media with carbon, nitrogen, minerals
Feedstocks: Traditional sugars (glucose, sucrose) or alternative (agricultural residues, waste glycerol)
Cell banking: Master cell bank (MCB) and working cell bank (WCB) for consistent production
Seed train: Scaling up inoculum from vial to production bioreactor
Bioreactor fermentation: Controlled conditions (pH, temperature, oxygen, agitation)

Stage 4: Downstream Processing

Step	Purpose	Methods
Harvest	Separate cells from broth	Centrifugation, filtration
Cell disruption (if intracellular)	Release intracellular product	Homogenization, bead milling
Purification	Isolate target product	Chromatography, membrane filtration
Concentration	Increase product concentration	Evaporation, ultrafiltration
Stabilization	Preserve product activity	Spray drying, lyophilization
Formulation	Prepare for food use	Blending with carriers

3.3 Applications of Precision Fermentation

Product Category	Target Molecule	Produced Using	Traditional Source
Animal-free dairy	Casein, whey	K. phaffii, S. cerevisiae	Cow’s milk
Plant-based meat	Heme (leghemoglobin)	K. phaffii	Soybean roots
Egg alternatives	Ovalbumin	K. phaffii, A. niger	Chicken eggs
Collagen/gelatin	Collagen	P. pastoris, E. coli	Animal tissues
Sweet proteins	Thaumatin, brazzein	E. coli, yeast	Fruit extracts
Enzymes	Rennet (chymosin), lactase	E. coli, K. lactis, A. niger	Calf stomach (rennet)
Flavors	Vanillin	Fermentation	Vanilla beans
Lipids	Milk fat analogs	Y. lipolytica	Animal fats

3.4 Safety Assessment of Precision Fermented Products

Key safety challenges identified by food safety authorities include :

Hazard Category	Specific Concerns	Assessment Method
Microbial hazards	Residual GMM DNA or cells in final product	PCR testing, viability assays
Chemical contaminants	Heavy metals from media; processing residues	ICP-MS, chromatography
Toxins	Secondary metabolites, mycotoxins	Bioassays, chromatography
Allergenicity	Novel proteins may be allergenic	Bioinformatics (allergen databases), serum testing
Nutritional disadvantage	Lower protein quality or bioavailability	Digestibility assays, amino acid profiling
Horizontal gene transfer	Antibiotic resistance marker genes	Bioinformatics, whole genome sequencing

Regulatory Requirements for GMM-derived Products :

High-quality genome assembly for producer strain
Bioinformatics analysis to evaluate potential pathogenicity and toxicity
Residual DNA testing (PCR-based; detection limit ≤10 ng DNA/g sample)
Demonstration of GMM removal from final product
Stability of genetic modification through production passages

Part 4: Nanobiotechnology in Food

4.1 Definition and Scope

Nanobiotechnology in food refers to the application of nanoscale materials (1-100 nm) and nanotechnology principles to food science. These technologies offer transformative potential for food production, preservation, and safety .

4.2 Applications

Application	Mechanism	Benefits
Nanoencapsulation	Encapsulating bioactive compounds in nanocarriers	Improved stability, solubility, controlled release
Nanosensors	Detection of pathogens, toxins, spoilage at nanoscale	Rapid, sensitive food safety monitoring
Nanocomposite packaging	Incorporating nanoparticles (silver, clay, ZnO) into packaging	Antimicrobial, barrier improvement
Nutrient delivery	Nanoemulsions, nanoliposomes for vitamins/nutraceuticals	Enhanced bioavailability
Anti-caking agents	Silicon dioxide nanoparticles	Prevent clumping in powdered foods

Nanoencapsulation Systems:

System	Description	Food Applications
Liposomes	Phospholipid bilayers encapsulating hydrophilic or hydrophobic compounds	Vitamins, enzymes, flavors
Nanoliposomes for nutraceuticals	Enhanced stability and bioavailability	Curcumin, omega-3 fatty acids
Nanolaminates	Layer-by-layer assembled coatings	Edible coatings for fruits, vegetables
Nanofibers	Electrospun polymer fibers	Encapsulation of probiotics, antimicrobials
Nanoemulsions	Oil-in-water or water-in-oil droplets (20-200 nm)	Flavors, antimicrobials, fat replacers

4.3 Safety and Regulatory Considerations

Concern	Description
Toxicity	Nanoparticles may have different toxicity profiles than bulk materials
Migration	Nanoparticles may migrate from packaging into food
Bioaccumulation	Potential to accumulate in tissues and organs
Environmental impact	Release into environment during production or disposal
Characterization challenges	Difficulty detecting and characterizing nanoparticles in food matrices

Regulatory Status: Nanoparticles in food require safety assessment on a case-by-case basis. Regulatory frameworks vary by jurisdiction; many classify them as “novel foods” or require specific approval .

Part 5: Enzyme Technology in Food Processing

5.1 Sources of Food Enzymes

Source	Examples	Advantages	Limitations
Plants	Papain (papaya), bromelain (pineapple), ficin (fig)	Natural, vegetarian	Seasonal availability
Animals	Rennet (calf stomach), pepsin, trypsin	Traditional	Ethical concerns, limited supply
Microorganisms	A. niger, B. subtilis, K. lactis, T. reesei	Consistent, scalable, lower cost	GMMs may face regulatory hurdles

5.2 Major Food Enzymes and Applications

Enzyme	Source	Application	Function
Amylases	A. niger, B. subtilis, barley malt	Baking, brewing, starch syrup production	Breaks starch into sugars
Proteases	A. niger, B. subtilis, papaya	Meat tenderizing, cheese making (rennet), protein hydrolysates	Breaks proteins into peptides/amino acids
Lipases	A. niger, Candida rugosa, Rhizopus	Cheese ripening, lipid modification	Breaks fats into fatty acids/glycerol
Lactase (β-galactosidase)	K. lactis, A. oryzae	Lactose-free milk production	Breaks lactose into glucose + galactose
Glucose oxidase	A. niger	Bread improvement, oxygen removal	Converts glucose + O₂ → gluconic acid + H₂O₂
Pectinases	A. niger	Juice clarification	Breaks pectin
Cellulases	T. reesei, A. niger	Juice extraction	Breaks cellulose
Transglutaminase	Streptoverticillium	Meat binding, protein crosslinking	Crosslinks proteins
Glucose isomerase	Streptomyces spp.	High-fructose corn syrup	Converts glucose to fructose
Chymosin (rennet)	K. lactis, A. niger (recombinant)	Cheese making	Coagulates milk (cleaves κ-casein)

5.3 Enzyme Immobilization

Definition: Attaching enzymes to inert supports to enable recovery and reuse.

Immobilization Method	Description	Advantages	Limitations
Adsorption	Physical binding to support (activated carbon, clay)	Simple, low cost	Weak binding, enzyme leakage
Covalent bonding	Chemical bonds between enzyme and support	Strong binding, stable	Harsh conditions, may reduce activity
Entrapment	Enzyme trapped in polymer matrix (alginate, polyacrylamide)	Mild conditions, no enzyme modification	Diffusion limitations
Encapsulation	Enzyme enclosed in semipermeable membrane	Protection from environment	Mass transfer resistance
Cross-linking	Enzyme aggregates cross-linked with glutaraldehyde	High density, no carrier needed	Harsh cross-linking

Benefits of Immobilization:

Reusability of expensive enzymes
Continuous processing possible
Improved enzyme stability
Easier product separation (no enzyme in final product)
Reduced processing costs

Part 6: Genetic Modification in Food

6.1 Techniques for Genetic Modification

Technique	Description	Applications
Agrobacterium-mediated transformation	Using A. tumefaciens to transfer DNA to plants	Most GM crops (soy, corn, cotton)
Biolistics (gene gun)	DNA-coated particles shot into cells	Monocot crops (wheat, rice)
CRISPR/Cas9	Precision gene editing; cuts DNA at specific location	Trait development without foreign DNA? Contested
Zinc finger nucleases (ZFNs)	Custom-designed DNA-binding proteins for targeted editing	Precision breeding
RNA interference (RNAi)	Silencing specific genes	Decaffeinated coffee, non-browning apples

6.2 Genetically Modified (GM) Crops

Common GM Traits:

Trait	Gene Source	Function	Crops
Herbicide resistance (glyphosate)	A. tumefaciens CP4 EPSPS	Tolerates glyphosate (Roundup)	Soy, corn, canola, cotton
Insect resistance (Bt)	Bacillus thuringiensis (Cry proteins)	Produces insecticidal protein	Corn, cotton, eggplant (Bt brinjal)
Drought tolerance	Various	Improved water-use efficiency	Corn (DroughtGard)
Virus resistance	Viral coat protein genes	Resistant to specific viruses	Papaya (Rainbow), squash
Delayed ripening	Antisense ACC synthase or PG genes	Longer shelf life	Tomato (Flavr Savr)
Enhanced nutrition	Daffodil, Pantoea (Golden Rice)	Beta-carotene (Vitamin A precursor)	Rice

GM Crop Acreage (Global):

Soybean: ~80% GM
Corn: ~30% GM
Cotton: ~80% GM (many countries)
Canola: ~75% GM

6.3 Hypoallergenic Foods through Biotechnology

Biotechnological approaches can reduce or eliminate food allergens :

Approach	Target	Method	Example
Enzyme treatment	Allergenic proteins (gluten, β-lactoglobulin)	Proteolytic digestion	Gluten-reduced wheat products
Fermentation	Allergenic proteins	Microbial proteases (LAB)	Sourdough bread with reduced gluten
Genetic modification	Major allergen genes	Gene silencing (RNAi)	Hypoallergenic peanuts, soybeans
Epitope modification	Allergen structure	Site-directed mutagenesis	Modified allergen proteins

Example: Transgenic soybeans with silenced genes for major allergen Gly m Bd 30K (P34 protein) showed significantly reduced allergenicity.

6.4 Safety and Regulation of GM Foods

Key Safety Assessment Areas :

Assessment	Questions Addressed
Substantial equivalence	Is GM food comparable to non-GM counterpart?
Allergenicity	Does novel protein resemble known allergens?
Toxicity	Does novel protein or unexpected metabolites pose toxicity risk?
Nutritional composition	Are key nutrients altered?
Antibiotic resistance markers	Are marker genes present? Risk of transfer?
Unintended effects	Did insertion disrupt other genes?

Regulatory Framework (Pakistan context):

PBS (Pakistan Biotechnology Society): National coordination
VDP (Varietal Development Program): GM crop variety approval
Environmental Protection Agency: Field trial oversight
Ministry of National Food Security: Food safety assessment

Part 7: Functional Foods and Nutraceuticals

7.1 Definitions

Term	Definition	Examples
Functional Food	Food that provides health benefits beyond basic nutrition	Probiotic yogurt, omega-3 eggs, fortified cereals
Nutraceutical	Dietary supplement delivering concentrated nutrients or bioactive compounds	Vitamin/mineral supplements, herbal extracts
Probiotic	Live microorganisms conferring health benefits	Lactobacillus, Bifidobacterium
Prebiotic	Non-digestible food ingredient stimulating beneficial gut bacteria	Inulin, FOS, GOS
Synbiotic	Combination of probiotics and prebiotics	Many commercial gut health products
Postbiotic	Bioactive compounds produced by probiotics	Bacteriocins, short-chain fatty acids

7.2 Bioactive Components

Component	Food Sources	Health Benefits
Dietary fiber	Whole grains, fruits, vegetables	Digestive health, cholesterol reduction
Omega-3 fatty acids	Fish oil, flaxseed, chia	Cardiovascular health, anti-inflammatory
Carotenoids (β-carotene, lycopene)	Carrots, tomatoes, leafy greens	Vision, antioxidant, cancer prevention
Polyphenols	Berries, tea, coffee, dark chocolate	Antioxidant, cardiovascular
Glucosinolates	Cruciferous vegetables (broccoli, cabbage)	Cancer prevention
Probiotic bacteria	Yogurt, kefir, kimchi	Gut health, immune modulation
Phytosterols	Plant oils, nuts, seeds	Cholesterol reduction

7.3 Nutrigenomics

Definition: The study of how genes interact with nutrients; how individual genetic variation affects metabolic response to diet .

Discipline	Focus
Nutrigenetics	How genetic variation affects nutrient metabolism
Nutrigenomics	How nutrients affect gene expression
Epigenetics	How diet causes heritable changes in gene expression

Applications:

Personalized nutrition based on genetic profile
Identifying genetic markers for diet-related disease risk
Developing foods for specific genetic populations
Dietary recommendations tailored to individual genotypes

Part 8: Food Safety and Quality Control

8.1 Biotechnological Methods for Pathogen Detection

Method	Principle	Detection Limit	Time
PCR/qPCR	Amplifies target DNA sequences	10-100 CFU/g	3-6 hours
ELISA	Antibody-based detection of antigens	10^3-10^4 CFU/g	2-4 hours
Lateral flow devices	Immunochromatographic strips	10^4-10^5 CFU/g	15-30 minutes
Biosensors	Biological recognition + transducer	Variable	Minutes
Next-generation sequencing	Whole genome detection	Very low	Days
Loop-mediated isothermal amplification (LAMP)	Isothermal DNA amplification	10-100 CFU/g	<1 hour

8.2 Predictive Modeling in Food Safety

Machine Learning Applications :

Support Vector Regression (SVR): Predicts food quality parameters (microbial counts, color, texture, lipid oxidation) based on treatment and storage conditions
Achieved mean absolute percentage error (MAPE) as low as 1.10% for certain parameters
Enables proactive quality control and shelf-life prediction

8.3 HACCP (Hazard Analysis Critical Control Point)

Biotechnological applications can be integrated into HACCP systems:

HACCP Principle	Biotech Application
Hazard analysis	Biosensors for pathogen detection
Critical control point identification	Real-time microbial monitoring
Critical limit establishment	Quantitative PCR for specific pathogens
Monitoring procedures	Automated sensors, rapid tests
Corrective actions	Fermentation control systems
Verification	Genetic fingerprinting for traceability
Record keeping	Digital documentation systems

8.4 Detection of GMM Residual DNA

The presence of residual genetically modified microorganism (GMM) DNA in final food products is a regulatory concern.

Testing Requirements:

Minimum 3 batches, each with 3 samples
Detection limit ≤10 ng DNA/g sample
Positive control: direct GMM DNA
Negative control: non-GMM microbial DNA
Method: PCR with specific primers for target, marker, and reporter genes

Interpretation: Detection of GMM DNA does not necessarily indicate presence of viable GMM, but indicates incomplete removal during downstream processing. Both viability and DNA testing may be required.

📝 Quick Reference Summary Table

Topic	Key Technologies	Applications	Regulatory Focus
Traditional Fermentation	LAB, yeast, molds	Dairy, bread, beer, fermented vegetables	GRAS organisms
Precision Fermentation	GMM (S. cerevisiae, K. phaffii, A. niger), CRISPR, bioreactors	Animal-free dairy, heme, enzymes, flavors	Novel food authorization, GMM safety
Nanobiotechnology	Nanoencapsulation, nanosensors, nanocomposites	Nutrient delivery, pathogen detection, active packaging	Nanomaterial safety assessment
Enzyme Technology	Immobilized enzymes, recombinant enzymes	Starch hydrolysis, cheese making, juice clarification	Processing aid status
Genetic Modification	CRISPR, Agrobacterium, biolistics	Herbicide resistance, insect resistance, enhanced nutrition	Substantial equivalence, allergenicity, environmental release
Functional Foods	Probiotics, prebiotics, bioactive compounds	Gut health, cardiovascular health, immune support	Health claim substantiation
Food Safety	PCR, ELISA, biosensors, ML predictive modeling	Pathogen detection, quality prediction, traceability	Validation, regulatory compliance

🌟 Key Takeaways

Traditional fermentation remains the foundation of food biotechnology, with LAB, yeasts, and filamentous fungi producing everything from yogurt and cheese to beer and soy sauce.
Precision fermentation represents a paradigm shift, using genetically modified microorganisms as “cell factories” to produce specific animal proteins (casein, whey, collagen) without animals .
Microbial host selection for precision fermentation involves trade-offs between growth rate, PTM capability, secretion efficiency, substrate flexibility, and regulatory status (GRAS/QPS) .
Downstream processing is often the most expensive and challenging step in precision fermentation, requiring efficient purification while removing all residual GMM DNA and cells .
Safety assessment of GM and precision-fermented foods requires multi-hazard analysis including allergenicity, toxicity, nutritional equivalence, and genetic stability .
Nanobiotechnology enables nanoencapsulation for improved nutrient delivery and nanosensors for rapid pathogen detection, but nanomaterial safety requires careful evaluation .
Enzyme immobilization allows recovery and reuse of expensive enzymes, making continuous processing economically feasible for industrial food applications.
Nutrigenomics links individual genetic variation to dietary response, paving the way for personalized nutrition based on genetic profiles .
GMM residual DNA detection using PCR with detection limits ≤10 ng/g is a regulatory requirement for genetically modified microorganism-derived products .
Predictive modeling using machine learning (SVR) can forecast food quality parameters, enabling proactive rather than reactive quality control in food processing

Recombinant DNA Technology (BTH-3172) – Comprehensive Study Notes

Course Overview

Attribute	Details
Course Code	BTH-3172
Course Title	Recombinant DNA Technology
Focus	Principles and applications of recombinant DNA technology including restriction enzymes, vectors, cloning strategies, library construction, screening, and analysis of recombinant molecules
Prerequisites	Molecular biology, biochemistry, genetics

Course Rationale: Recombinant DNA technology (genetic engineering) involves the joining together of DNA molecules from different sources and the insertion of these molecules into host organisms (vectors) where they can be propagated and expressed. This technology has revolutionized molecular biology, medicine, agriculture, and biotechnology, enabling production of recombinant proteins (insulin, growth hormone, vaccines), genetically modified organisms (GMO crops, transgenic animals), gene therapy, and genome editing.

PART 1: Introduction to Recombinant DNA Technology

1.1 Definition and Scope

Recombinant DNA (rDNA) technology is the set of techniques for joining DNA molecules from different sources (often different species) and inserting them into a host organism (vector) for replication and/or expression.

Key capabilities enabled by rDNA technology:

Capability	Description	Example
Gene isolation	Isolate specific genes from complex genomes	Human insulin gene
Gene cloning	Produce multiple identical copies of a gene	Amplify gene for sequencing or expression
Gene expression	Produce protein product of a cloned gene	Recombinant insulin, growth hormone
Gene modification	Alter gene sequence (mutagenesis)	Site-directed mutagenesis for structure-function studies
Gene transfer	Insert genes into organisms (transgenesis)	GMO crops, transgenic animals
Genome editing	Precise modification of genomes	CRISPR-Cas9 for gene knockout, correction

1.2 Historical Milestones

Year	Event	Significance
1953	Watson & Crick propose DNA double helix structure	Foundation for understanding DNA replication and function
1960s	Discovery of restriction endonucleases (Arber, Linn, Meselson, Yuan, Danna, Nathans)	Enzymes that cut DNA at specific sequences
1972	First recombinant DNA molecule created (Berg, Cohen, Boyer)	SV40 DNA + lambda phage DNA
1973	First cloning of a gene (Cohen, Boyer)	Bacterial plasmid used as vector
1975	Southern blot developed (Southern)	Detection of specific DNA sequences
1977	DNA sequencing methods developed (Sanger; Maxam & Gilbert)	Determining DNA sequence
1978	First recombinant human protein produced (insulin)	Bacteria producing human insulin
1982	First GMO approved (human insulin, Eli Lilly)	First recombinant pharmaceutical
1983	First transgenic plant produced (tobacco)	Agrobacterium-mediated transformation
1985	Polymerase chain reaction (PCR) invented (Mullis)	Amplification of specific DNA sequences
1990	First human gene therapy trial	ADA-SCID patient treated
1996	First cloned mammal (Dolly the sheep)	Somatic cell nuclear transfer
2012	CRISPR-Cas9 genome editing (Doudna, Charpentier)	Precise, efficient genome editing

PART 2: Tools of Recombinant DNA Technology

2.1 Restriction Endonucleases (Restriction Enzymes)

Definition: Enzymes that recognize specific palindromic DNA sequences and cleave the DNA backbone at or near those recognition sites.

Naming convention: First letter: genus; next two letters: species; roman numeral: order of discovery

EcoRI: Escherichia coli RY13, first enzyme
HindIII: Haemophilus influenzae serotype d, third enzyme

Types of Restriction Enzymes:

Type	Recognition site	Cleavage	Cofactors	Examples	Use in rDNA
Type I	Bipartite, asymmetric	Random distance from site (100-1000 bp away)	ATP, Mg²⁺, SAM	EcoKI, EcoAI	Not useful (non-specific cleavage)
Type II	Palindromic (4-8 bp)	Within recognition site	Mg²⁺ only	EcoRI, HindIII, BamHI, XbaI	Most common in rDNA technology
Type IIs	Asymmetric	Defined distance outside recognition site	Mg²⁺	BsmBI, FokI	Used in Golden Gate assembly
Type III	Asymmetric (2-3 bp)	20-30 bp from recognition site	ATP, Mg²⁺	EcoP15I	Rarely used

Type II Restriction Enzymes (most important for rDNA):

Enzyme	Recognition Sequence (5′ → 3′)	Overhang	Source
EcoRI	G↓A A T T C	5′ overhang (sticky end)	E. coli RY13
HindIII	A↓A G C T T	5′ overhang	H. influenzae Rd
BamHI	G↓G A T C C	5′ overhang	Bacillus amyloliquefaciens H
XbaI	T↓C T A G A	5′ overhang	Xanthomonas badrii
PstI	C T G C A↓G	3′ overhang	Providencia stuartii
SmaI	C C C↓G G G	Blunt end	Serratia marcescens
EcoRV	G A T↓A T C	Blunt end	E. coli J62 pLG74
NotI	G↓C G G C C G C	5′ overhang (8 bp cutter)	Nocardia otitidis-caviarum

Isoschizomers: Different restriction enzymes that recognize the same sequence (e.g., SmaI and XmaI both recognize CCCGGG; SmaI cuts blunt, XmaI cuts with 5′ overhang).

Star activity: Relaxed specificity under non-optimal conditions (high glycerol, low salt, high pH, high enzyme concentration, presence of organic solvents) → cleavage at non-canonical sites.

2.2 DNA Ligase

Function: Catalyzes formation of phosphodiester bonds between adjacent 3′-OH and 5′-phosphate ends of DNA.

Types and sources:

Source	Features	Optimal temperature	Applications
E. coli DNA ligase	Requires NAD⁺ as cofactor	16-25°C	Sticky end ligation
T4 DNA ligase	Requires ATP as cofactor	16-25°C (optimal 16°C for blunt ends); active at 4-37°C	Most common; sticky ends (room temperature), blunt ends (16°C overnight), linker ligation
T7 DNA ligase	Requires ATP	16-25°C	Sticky end ligation (poor with blunt ends)
Mammalian DNA ligase I, III, IV	ATP-dependent	37°C	DNA repair, replication, V(D)J recombination

Factors affecting ligation:

DNA ends: Sticky (cohesive) ends ligate efficiently (high local concentration) at room temperature in minutes; blunt ends ligate slowly (requires higher enzyme concentration, longer incubation at 16°C overnight)
ATP concentration: Optimal ~0.5-1 mM; excess inhibits
pH: Optimal pH 7.5-8.0
Temperature: 16°C optimal for blunt ends (balances activity and stability); 25°C for sticky ends (faster, stable for shorter fragments)
Concentration: High DNA concentration favors intermolecular ligation; low DNA concentration favors intramolecular ligation (circularization)

2.3 DNA Polymerases

Polymerase	Source	Features	Applications
DNA polymerase I (Pol I)	E. coli	5’→3′ polymerase; 3’→5′ exonuclease (proofreading); 5’→3′ exonuclease (nick translation)	Nick translation (DNA labeling); second strand synthesis
Klenow fragment	E. coli Pol I (large fragment)	5’→3′ polymerase; 3’→5′ exonuclease (no 5’→3′ exonuclease)	Fill-in 5′ overhangs; labeling; second strand synthesis
T4 DNA polymerase	T4 phage	5’→3′ polymerase; strong 3’→5′ exonuclease (more active than Klenow)	Blunt-ending DNA fragments; fill-in or chew-back ends
T7 DNA polymerase	T7 phage	5’→3′ polymerase; strong 3’→5′ exonuclease	Sanger sequencing (dideoxy chain termination)
Taq DNA polymerase	Thermus aquaticus	5’→3′ polymerase; no 3’→5′ exonuclease (no proofreading); 5’→3′ exonuclease (less active for nick translation)	PCR (thermostable; optimal 72°C); adds 3′-A overhang
Pfu DNA polymerase	Pyrococcus furiosus	5’→3′ polymerase; 3’→5′ exonuclease (proofreading; high fidelity)	High-fidelity PCR for cloning, mutagenesis
Reverse transcriptase	Retroviruses (AMV, M-MLV)	RNA-dependent DNA polymerase; also DNA-dependent DNA polymerase	cDNA synthesis from RNA; RT-PCR

2.4 Alkaline Phosphatase

Function: Removes 5′ phosphate groups from DNA or RNA.

Source	Features	Inactivation	Application
Bacterial alkaline phosphatase (BAP)	E. coli	Heat inactivation at 65°C (but difficult; residual activity)	Removing phosphate from vector to prevent self-ligation
Calf intestinal alkaline phosphatase (CIP)	Calf intestine	Heat inactivation at 75°C or phenol extraction	Same as BAP (more heat-labile, preferred)
Shrimp alkaline phosphatase (SAP)	Shrimp	Heat inactivation at 65°C (easy, rapid)	Same (heat-labile, convenient)

Use in cloning: Vector digested with restriction enzyme → dephosphorylation (removes 5′ phosphates) → prevents self-ligation → only inserts with 5′ phosphates can ligate.

2.5 Polynucleotide Kinase (PNK)

Function: Transfers γ-phosphate from ATP to 5′-OH ends of DNA or RNA (phosphorylation).

Source: T4 bacteriophage

Uses:

Labeling 5′ ends with [γ-³²P]ATP for probes
Adding 5′ phosphate to synthetic oligonucleotides (primers, linkers, adapters) for ligation
Creating 5′ phosphate for ligation of dephosphorylated vectors

PART 3: Cloning Vectors

3.1 General Features of a Cloning Vector

Feature	Purpose
Origin of replication (ori)	Allows replication in host cell (controls copy number)
Selectable marker (antibiotic resistance)	Allows selection of host cells containing vector (e.g., ampicillin, kanamycin, tetracycline resistance)
Multiple cloning site (MCS) / polylinker	Cluster of unique restriction sites for inserting foreign DNA
Screening marker (e.g., lacZ α-complementation)	Distinguishes recombinant clones (blue-white screening)
Small size (ideal)	Easier manipulation; higher transformation efficiency
High copy number (for cloning)	Amplification of DNA (e.g., pUC vectors: 500-700 copies/cell)
Sequencing primers	Allows sequencing of inserted DNA directly

3.2 Plasmid Vectors

Plasmids: Small, circular, extrachromosomal double-stranded DNA molecules (1-200 kbp) that replicate autonomously in bacteria.

Ideal properties of plasmid vectors:

Small size (2-5 kbp for easy manipulation, transformation)
High copy number (many copies per cell – pUC family, pBluescript, pGEM)
Multiple unique restriction sites (MCS/polylinker)
Antibiotic resistance marker (ampicillin, kanamycin, chloramphenicol, tetracycline)
Origin of replication (ColE1, pMB1, p15A)
Screening marker (lacZ α-complementation for blue-white screening)
Sequencing primer sites (M13 forward/reverse, T3, T7, SP6 promoters)

Copy number control:

Plasmid	ori	Copy number per cell	Example
Low copy	pSC101	1-5	Cloning large inserts (unstable if high copy)
Medium copy	ColE1 (wild-type)	15-20	pBR322 (~15-20 copies/cell)
High copy	pUC (pMB1 with mutations)	500-700	pUC18/19, pBluescript, pGEM
High copy	pBR322 derivative (rop⁻)	300-500	pGEM, pBluescript

Cloning procedure (plasmid):

Digest vector and insert with same restriction enzyme (or compatible ends)
Purify vector and insert fragments (gel extraction)
Ligate vector and insert (T4 DNA ligase)
Transform competent E. coli
Select on antibiotic plates (e.g., ampicillin)
Screen for recombinants (blue-white screening; colony PCR; restriction digest)

Blue-white screening (lacZ α-complementation):

Component	Function
lacZ gene (β-galactosidase)	Only α-peptide (first 146 aa) in MCS of vector; host strain (e.g., DH5α) provides ω-fragment (remainder of lacZ)
IPTG	Inducer of lac operon (non-hydrolyzable analog of allolactose)
X-gal (5-bromo-4-chloro-3-indolyl-β-D-galactopyranoside)	Chromogenic substrate; cleaved by β-galactosidase → blue product
Selection:	White colonies → insert present (disrupts lacZα) → recombinant; Blue colonies → no insert (vector self-ligates) → non-recombinant

3.3 Bacteriophage λ Vectors

Features: Can accommodate larger inserts (up to 20 kbp) than plasmids.

Two types:

Type	Capacity	Cloning method	Use
Insertion vectors (λgt10, λgt11)	Up to 10 kbp	Insert into unique restriction site	cDNA libraries
Replacement vectors (λEMBL, λDASH)	9-23 kbp	Replace stuffer fragment between two restriction sites	Genomic libraries

λ packaging extracts: In vitro packaging of λ DNA into phage heads using extract containing preformed head and tail proteins.

Transduction: Phage infects E. coli → λ DNA injected into cell → phage genes expressed → lysis or lysogeny (depending on vector design; insertion vectors often designed to form plaques without lysogeny; replacement vectors often use spi selection; many λ vectors are designed for lytic growth only, not lysogeny).

3.4 Cosmid Vectors

Features: Hybrid of plasmid + λ cos site (cohesive end site). Can accommodate inserts up to 45 kbp.

Key elements:

Plasmid origin of replication (ori) and selectable marker (antibiotic resistance)
λ cos site (required for packaging into phage head)
Multiple cloning site (MCS)

Cloning procedure:

Digest cosmid at unique restriction site within MCS (cosmid vector)
Ligate insert DNA (size fractionated 30-45 kbp)
Package ligated DNA into λ phage heads (using λ packaging extract, requires cos sites in proper orientation (cos sites ~45 kbp apart))
Infect E. coli – phage injects cosmid DNA (circularizes via cos site cohesion), which replicates as plasmid
Select on antibiotic plates (ampicillin, kanamycin)

3.5 BAC and YAC Vectors

Feature	Bacterial Artificial Chromosome (BAC)	Yeast Artificial Chromosome (YAC)
Insert size	100-300 kbp	100-2000 kbp
Host	E. coli	Saccharomyces cerevisiae
Key elements	F-factor origin of replication (oriS, repE), parA, parB (partitioning), selectable marker (chloramphenicol resistance)	CEN (centromere), ARS (autonomous replicating sequence), TEL (telomeres), selectable markers (URA3, TRP1, LEU2, HIS3)
Advantages	Stable (low copy number, prevents recombination); large inserts; easy to manipulate (electroporation)	Very large inserts; functional complementation in yeast
Disadvantages	Low yield of DNA (low copy number; can be amplified)	Chimerism (rearrangements, deletions, insertions)
Use	Genome sequencing (Human Genome Project), physical mapping, functional studies	Genome mapping (large-scale physical maps)

3.6 Expression Vectors

Purpose: Produce recombinant protein product from cloned gene.

Key elements (in addition to basic vector features):

Element	Function
Promoter	Drives transcription of gene (inducible: lac, tac, trp, T7, araBAD, tet; constitutive: CMV, SV40)
Ribosome binding site (RBS) (Shine-Dalgarno sequence in bacteria)	Binds to 16S rRNA for translation initiation (AGGAGG)
Start codon (ATG)	Translation initiation (initiation codon)
Terminator	Stops transcription (prevents read-through)
Transcription terminator (in eukaryotes)	Polyadenylation signal (AAUAAA) and termination
Affinity tag (His₆, GST, MBP, FLAG, HA, c-Myc)	Protein purification and detection
Protease cleavage site (thrombin, TEV, enterokinase, Factor Xa)	Removes affinity tag after purification
Secretion signal (pelB, ompA, phoA for bacteria; α-factor for yeast)	Direct protein to periplasm (bacteria) or media (yeast) for easier purification and disulfide bond formation

Common expression systems:

System	Host	Promoter	Inducer	Advantages	Disadvantages
pET (T7 system)	E. coli (BL21(DE3) – contains T7 RNA polymerase gene under lacUV5)	T7	IPTG	High expression; tightly regulated; many vectors for tags	Leaky expression toxic for some proteins
pGEX	E. coli	tac (or trc)	IPTG	GST tag for easy purification (glutathione affinity)	Solubility problems; GST large (26 kDa)
pMAL	E. coli	tac	IPTG	MBP tag improves solubility; amylose affinity	MBP large (40 kDa)
pBAD	E. coli	araBAD	L-arabinose	Tight regulation; tunable expression (very low basal)	Arabinose required; catabolite repression
pQE	E. coli	T5 (phage)	IPTG	His₆ tag; high expression; Ni-NTA purification	His tag can interfere with folding (rare)
Pichia pastoris	Yeast	AOX1	Methanol	High yield (grams/L), secretion, eukaryotic folding (disulfide bonds, glycosylation)	Methanol flammability; glycosylation differs from mammals (high mannose)
Baculovirus (BEVS)	Insect cells (Sf9, Sf21, High Five)	Polyhedrin (very late, very strong)	Viral infection (recombinant bacmid)	Eukaryotic processing; high level; glycosylation similar to mammals (but not identical); large proteins	Time-consuming; virus amplification steps
Mammalian (CHO, HEK293)	Mammalian cells	CMV (human cytomegalovirus immediate-early promoter)	Constitutive (viral infection or transfection)	Proper folding, processing, glycosylation (human-like), secretion, post-translational modifications	Low yield; expensive media; slow

3.7 Shuttle Vectors

Definition: Vectors that can replicate in two different host organisms (e.g., E. coli and yeast; E. coli and mammalian cells; E. coli and plants via Agrobacterium).

Key elements:

Two origins of replication (e.g., ColE1 for E. coli; 2μ for yeast; SV40 ori for mammalian)
Two selectable markers (e.g., ampicillin resistance for bacteria; URA3, TRP1, LEU2, HIS3 for yeast; neomycin resistance for mammalian)
Multiple cloning site (MCS)

Examples:

Vector	Hosts	Application
YEp (Yeast episomal plasmid)	E. coli + yeast (S. cerevisiae)	Yeast expression
pYAC (Yeast artificial chromosome)	E. coli + yeast	Large inserts (100-2000 kbp) for genome mapping
pEGFP (Clontech)	E. coli + mammalian	Expression of GFP fusion proteins in mammalian cells
pMSCV (retroviral)	E. coli + mammalian (retrovirus packaging)	Stable gene delivery to mammalian cells
pBIN (binary vector)	E. coli + Agrobacterium tumefaciens	Plant transformation

PART 4: Polymerase Chain Reaction (PCR)

4.1 Basic PCR

Invented by: Kary Mullis (1985); Nobel Prize in Chemistry 1993.

Principle: Exponential amplification of specific DNA sequence using thermostable DNA polymerase, primers complementary to target sequence, and thermal cycling.

Components of PCR reaction:

Component	Function	Final concentration (typical)
Template DNA	Contains target sequence	1-10 ng (plasmid); 10-100 ng (genomic DNA)
Forward primer	Binds to sense strand, provides 3′-OH for extension	0.1-0.5 μM
Reverse primer	Binds to antisense strand, provides 3′-OH for extension	0.1-0.5 μM
dNTPs (dATP, dCTP, dGTP, dTTP)	Substrates for DNA polymerase	200 μM each
Thermostable DNA polymerase (Taq, Pfu, Phusion, Q5, KOD)	Extends primers	0.5-2.5 units/50 μL
MgCl₂ or MgSO₄	Cofactor for DNA polymerase (stabilizes primer-template binding)	1.5-2.5 mM
Reaction buffer	Provides optimal pH, ionic strength, and (for some polymerases) KCl, (NH₄)₂SO₄, Tris-Cl, BSA	1×
BSA (optional)	Stabilizes polymerase, reduces adsorption to tube walls	0.1-1 mg/mL

Thermal cycling parameters:

Step	Temperature	Time	Purpose	Notes
Initial denaturation	94-98°C	2-5 min	Denature template DNA (complete separation of strands)	Longer for genomic DNA; not needed for plasmids if denaturation in first cycle sufficient
Denaturation	94-98°C	15-30 sec	Separate DNA strands	High temperature required (higher GC content → higher denaturation temp)
Annealing	45-68°C (depends on primer Tm)	15-30 sec	Primers bind to complementary sequences	Tm ≈ 2°C × (A+T) + 4°C × (G+C) (for primers <20 nt); more accurate: Tm = 81.5 + 0.41(%GC) – 675/N (N = primer length) – % mismatch; typically set 5°C below calculated Tm
Extension	68-72°C	30-60 sec per kbp	DNA polymerase extends primers	Taq: 72°C; Pfu: 72°C; Phusion: 72°C; extension time depends on amplicon length
Final extension	68-72°C	5-10 min	Complete partial extensions	Ensures full-length products
Hold	4-10°C	∞	Store reaction

Cycle number: 25-35 cycles (exponential amplification: 2ⁿ-fold after n cycles; plateau after ~25-30 cycles due to enzyme exhaustion, substrate depletion, product inhibition, nonspecific amplification)

4.2 Reverse Transcription PCR (RT-PCR)

Purpose: Convert RNA to cDNA using reverse transcriptase, then amplify cDNA by PCR.

Steps:

RNA isolation (preferably with DNase treatment to remove genomic DNA contamination)
Reverse transcription: RNA + oligo(dT) primer (binds poly-A tail), random hexamers, or gene-specific primer + reverse transcriptase (M-MLV (RNase H⁻) or AMV) + dNTPs → cDNA
PCR amplification of cDNA using gene-specific primers (design primers that span exon-exon junctions to avoid genomic DNA amplification)

Uses:

Gene expression analysis (RT-qPCR)
cDNA library construction
Cloning of coding sequences from RNA
Detection of RNA viruses (HIV, HCV, SARS-CoV-2)

4.3 Quantitative PCR (qPCR / Real-Time PCR)

Purpose: Quantify amount of target DNA (or cDNA) in real time during PCR.

Detection chemistries:

Method	Principle	Advantages	Disadvantages
SYBR Green I	Dye binds double-stranded DNA (dsDNA); fluorescence increases as dsDNA accumulates	Inexpensive; no probe required; works with any primer pair	Non-specific (binds any dsDNA, including primer-dimers, nonspecific products); requires melt curve analysis to verify specificity
TaqMan probe	Hydrolysis probe with reporter and quencher; 5’→3′ exonuclease activity of Taq polymerase cleaves probe during extension; separates reporter from quencher → fluorescence	Highly specific (requires target-specific probe); multiplexing possible (different dyes)	Expensive; requires probe design for each target
Molecular beacon	Hairpin probe with reporter and quencher; opens when hybridized to target	High specificity; sensitive	Complex design; expensive
SYTO 9, SYTO 82	dsDNA-binding dyes with lower background, less sensitive to GC content	More compatible with some instruments	Less common

Quantification methods:

Method	Description	Use
Standard curve (absolute quantification)	Compare threshold cycle (Ct) values to standard curve from known quantities of target DNA	Absolute copy number (if known standard available)
ΔΔCt (relative quantification)	Compare target gene to reference gene (housekeeping gene: GAPDH, β-actin, 18S rRNA, HPRT1); ΔCt = Ct(target) – Ct(ref); ΔΔCt = ΔCt(sample) – ΔCt(calibrator); Fold change = 2⁻ᵟᵟᶜᵗ	Gene expression changes (most common)

Ct (threshold cycle): Cycle at which fluorescence exceeds threshold (background). Lower Ct → higher starting template amount.

4.4 Applications of PCR

Application	Description
Gene cloning	Amplify coding sequence for insertion into expression vector
Mutagenesis	Site-directed, site-saturation, random mutagenesis
Genotyping	SNP detection, allele-specific PCR, microsatellite analysis
Diagnostics	Detection of pathogens (bacterial, viral, fungal) – SARS-CoV-2, HIV, hepatitis B/C, tuberculosis (TB), chlamydia, gonorrhea
Forensics	DNA fingerprinting (short tandem repeat – STR analysis)
Ancient DNA	Amplify degraded DNA from fossils, museum specimens
Environmental microbiology	Detect microorganisms in soil, water, air (16S rRNA gene for bacterial community analysis)

PART 5: Molecular Cloning Strategies

5.1 Traditional Restriction Cloning

Step	Procedure
1	PCR amplify insert with primers containing restriction sites (add 4-6 extra bases 5′ of restriction site for efficient cutting)
2	Digest PCR product with restriction enzymes (gel purify after digest to remove small fragments)
3	Digest vector with same restriction enzymes (or compatible ends)
4	Treat vector with alkaline phosphatase (CIP, SAP) if using single restriction site to prevent self-ligation (prevents vector background)
5	Ligate insert and vector (T4 DNA ligase; molar ratio insert:vector = 3:1 for sticky ends, 5:1 for blunt ends)
6	Transform competent cells (chemical or electroporation; many E. coli strains: DH5α, DH10B, TOP10, XL1-Blue, Stbl3 for unstable inserts)
7	Select transformants (antibiotic selection; blue-white screening if applicable)
8	Screen colonies (colony PCR, restriction digest of miniprep DNA, sequencing)

Advantages: Simple, inexpensive, familiar
Disadvantages: Requires compatible restriction sites; cannot easily transfer inserts between vectors; scar sequence (remnant restriction site) may affect protein function (adds 4-8 extra amino acids)

5.2 Gateway Cloning (Invitrogen/Thermo Fisher)

Principle: Site-specific recombination using bacteriophage λ integrase system.

Key elements:

att sites: attL1, attL2 (entry clones); attR1, attR2 (destination vectors)
Entry clone: PCR product + attB1/attB2 sequences (via BP reaction) → attL sites
Destination vector: attR1, attR2, selection marker (ccdB toxic gene), expression elements (promoter, tag, etc.)
LR reaction: Entry clone (attL) + Destination vector (attR) → Expression clone (attB)

Steps:

PCR amplify gene with attB1 and attB2 tails
BP reaction: attB-PCR product + donor vector (pDONR) → entry clone (attL)
LR reaction: entry clone + destination vector → expression clone (attB)
Transform expression clone into expression host

Advantages: No restriction sites; high efficiency (95-99% recombinants); easy transfer between vectors (multiple destination vectors available with different tags, promoters, selectable markers); orientation-specific
Disadvantages: High cost (commercial kits); requires specific vectors; additional sequence left behind (attB scar: ~25 bp, 8-9 amino acids) may affect protein function

5.3 TOPO Cloning (Invitrogen/Thermo Fisher)

Principle: Topoisomerase I from vaccinia virus covalently attaches to DNA and ligates overhangs.

Types:

Type	Vector	Insert requirement	Use
TOPO blunt	Blunt-ended PCR product (requires blunt ends; use proofreading polymerase: Pfu, Phusion, Q5, KOD)	Blunt ends	Routine cloning (95-99% efficiency)
TOPO TA	PCR product with 3′-A overhang (Taq polymerase adds A)	3′-A overhang	Routine cloning (Taq products)
pENTR/D-TOPO	Directional TOPO (CACC added to forward primer; vector has GTGG overhang)	Directional (compatible overhangs)	Gateway entry clone construction

Advantages: Rapid (5-10 min ligation); high efficiency (almost all colonies contain insert); no restriction enzyme digestion; no ligase required (topoisomerase I provides ligation)
Disadvantages: Expensive; requires specific vectors (TOP10 competent cells included in many kits); directional TOPO requires careful primer design

5.4 Gibson Assembly (Gibson et al., 2009; New England Biolabs)

Principle: Isothermal, single-reaction assembly of multiple DNA fragments with overlapping ends (15-40 bp homology) using three enzymes:

T5 exonuclease: Generates 3′ overhangs by chewing back 5′ ends (removes 5′ mononucleotides)
Phusion DNA polymerase: Fills gaps (extends 3′ ends using complementary overhangs)
Taq DNA ligase: Seals nicks (joins DNA backbones)

Reaction conditions: Single tube, 50°C for 15-60 minutes (isothermal; enzymes active simultaneously).

Advantages: Can assemble multiple fragments (2-6 fragments typical; up to 10-15 possible); no restriction sites required; no scar sequence (only added homology region, which can be removed by primer design); ideal for synthetic biology, multigene constructs, and large plasmids
Disadvantages: Requires overlapping ends (designed into primers); larger inserts (>10 kbp) may be less efficient; homologous recombination in host can cause rearrangements for repetitive sequences

5.5 Golden Gate Assembly (Engler et al., 2008)

Principle: Type IIs restriction enzymes (e.g., BsaI, BsmBI, BbsI) cut outside their recognition sequence, generating 4 bp overhangs. By designing overhangs, multiple fragments can be assembled in defined order in single reaction.

Reaction: Restriction digest + ligation simultaneously in one tube (thermocycler: 37°C (digest) → 16°C (ligation) → 37°C (final digest to remove uncut fragments) cycles repeated 20-30 times).

Advantages: Seamless assembly (no scar sequence, if overhangs designed to form correct junctions); modular (standardized parts); one-pot reaction (2-10 fragments)
Disadvantages: Requires Type IIs sites absent in fragments; overhang design critical (different overhangs for each junction; avoid compatible overhangs that could misassemble); relatively expensive

5.6 Ligation Independent Cloning (LIC)

Principle: T4 DNA polymerase has 3’→5′ exonuclease activity in absence of dNTPs; chews back to create complementary single-stranded overhangs.

Procedure: Vector and insert PCR with primers containing specific tails → T4 DNA polymerase treatment (without dNTPs) creates defined complementary overhangs (12-15 nt) → anneal (no ligase required; nicks sealed in host after transformation) → transform.

Advantages: No restriction or ligation required; high efficiency; can be automated
Disadvantages: Requires careful primer design; specific buffer conditions; requires proofreading polymerase for insert amplification

PART 6: DNA Library Construction

6.1 Genomic DNA Libraries

Definition: Collection of cloned DNA fragments representing entire genome of an organism.

Steps:

Step	Procedure
1	Isolate high molecular weight genomic DNA (avoid shearing; use gentle extraction: phenol-chloroform, commercial kits)
2	Partially digest DNA with restriction enzyme (e.g., Sau3AI

Study Notes: Biochemical Engineering (BTH-3192)

1. Introduction to Biochemical Engineering

1.1 What is Biochemical Engineering?

Biochemical Engineering is a sub-discipline of chemical engineering that bridges the gap between laboratory-scale biology (molecular biology, microbiology, biochemistry) and large-scale industrial manufacturing . It focuses on the design, development, and optimization of processes involving biological catalysts (enzymes, microorganisms, animal or plant cells) for the production of pharmaceuticals, biofuels, food ingredients, and other biochemicals .

Key Distinction:

Biotechnology is the broad scientific discipline (what is possible).
Biochemical Engineering is the engineering application (how to do it economically at scale).

1.2 The Bioprocess Pipeline

The typical industrial bioprocess is divided into three main stages, a framework that is central to understanding biochemical engineering as highlighted in multiple university curricula :

Stage	Description	Key Operations
Upstream Processing (USP)	Preparation of raw materials, media formulation, sterilization, and inoculum development.	Media preparation, sterilization, inoculum propagation.
Bioreaction (Fermentation/Cell Culture)	The core conversion step where cells or enzymes convert substrates into the desired product under controlled conditions.	Bioreactor operation (batch, fed-batch, continuous), monitoring and control of pH, temperature, dissolved oxygen.
Downstream Processing (DSP)	Recovery, purification, and formulation of the product from the bioreactor broth.	Cell separation (centrifugation, filtration), cell disruption, purification (chromatography, extraction), formulation (drying, crystallization).

1.3 Why Biochemical Engineering?

High Specificity: Biological catalysts are highly specific, reducing side reactions.
Mild Conditions: Reactions occur at ambient temperature and pressure, saving energy.
Renewable Feedstocks: Utilizes renewable biomass (e.g., corn, sugarcane, lignocellulose) instead of petrochemicals.
Complex Molecules: Enables the production of complex therapeutic proteins (e.g., insulin, monoclonal antibodies) that cannot be synthesized chemically .

2. Enzyme Kinetics and Biocatalysis

Enzymes are biological catalysts that accelerate biochemical reactions. Understanding their kinetics is fundamental to designing enzyme reactors .

2.1 The Michaelis-Menten Model

The standard model for enzyme kinetics describes the rate of reaction ( $v$ ) as a function of substrate concentration ( $[S]$ ).

Mechanism:
$E + S ⇌ ES \to E + P$

Michaelis-Menten Equation:
$v = K ^{m} + [ S ] v ^{ma x} \cdot [ S ]$

Key Parameters:

$v_{ma x}$ : Maximum reaction rate when all enzyme active sites are saturated with substrate.
$K_{m}$ (Michaelis Constant): The substrate concentration at which $v = 2 1 v_{ma x}$ . It is a measure of the enzyme’s affinity for its substrate (lower $K_{m}$ = higher affinity).

2.2 Immobilized Enzymes

Enzymes can be attached to solid supports (immobilized) to enhance process economics .

Method	Description	Advantages	Disadvantages
Physical Adsorption	Enzyme binds to support via weak forces (van der Waals, H-bonds).	Simple, cheap, no reagents needed.	Weak binding; enzyme leaches out easily.
Covalent Bonding	Enzyme is chemically bonded to a functional group on the support.	Strong, stable binding; no leakage.	Can alter enzyme active site, reducing activity; expensive.
Encapsulation/Entrapment	Enzyme is trapped inside a polymer matrix (e.g., alginate beads).	Mild conditions; protects enzyme.	Diffusion limitations for substrates/products.

Advantages of Immobilization:

Reusability: Enzyme can be recovered and reused in multiple batches.
Continuous Operation: Enables continuous flow processes.
Product Purity: Enzyme is not in the final product solution, simplifying purification.
Enhanced Stability: Often improves thermal and pH stability.

3. Microbial Growth Kinetics

For fermentation processes using living cells (bacteria, yeast, fungi), the kinetics of cell growth and product formation must be modeled .

3.1 Batch Growth Curve

In a closed batch fermenter, microbial growth follows a characteristic pattern:

Phase	Characteristics
Lag Phase	Cells adapt to the new environment; synthesize necessary enzymes; little to no growth.
Exponential (Log) Phase	Cells grow at their maximum specific growth rate ( $μ_{ma x}$ ); balanced growth.
Stationary Phase	Growth rate equals death rate due to nutrient depletion or toxic byproduct accumulation.
Death Phase	Cell viability declines exponentially.

3.2 Monod Kinetics

Analogous to the Michaelis-Menten equation, the Monod model describes how the specific growth rate ( $μ$ ) depends on the limiting substrate concentration ( $[S]$ ) .

Monod Equation:
$μ = K ^{s} + [ S ] μ ^{ma x} \cdot [ S ]$

$μ$ (specific growth rate, $h^{-1}$ ): $μ = X 1 \cdot d t d X$ , where $X$ is cell concentration.
$μ_{ma x}$ : Maximum specific growth rate when substrate is not limiting.
$K_{s}$ : Substrate saturation constant; $[S]$ at which $μ = 2 1 μ_{ma x}$ .

Stoichiometry (Yield Coefficients):

$Y_{X / S}$ (Biomass yield): $Y_{X / S} = Mass of substrate consumed Mass of cells produced = - d S d X$
$Y_{P / S}$ (Product yield): $Y_{P / S} = Mass of substrate consumed Mass of product formed = - d S d P$

4. Bioreactor Design and Operation

The bioreactor is the heart of the bioprocess. It must provide a controlled environment for optimal cell growth or enzyme activity .

4.1 Main Bioreactor Types

Type	Characteristics	Applications
Stirred Tank Reactor (STR)	Mechanical agitation; excellent mixing and gas dispersion; versatile.	Most common (antibiotics, enzymes, proteins).
Bubble Column	No moving parts; mixing by gas sparging.	Shear-sensitive cultures (e.g., some plant cells).
Air-Lift Reactor	Draft tube creates internal circulation; low shear; good heat transfer.	Mammalian cell culture; waste treatment.
Packed Bed Reactor	Immobilized enzymes/cells packed in a column; continuous operation.	Biocatalysis; wastewater treatment.

4.2 Mass Transfer: Oxygen Transfer Rate (OTR)

In aerobic fermentations, oxygen is often the limiting substrate due to its low solubility in water .

Driving Force: The rate of oxygen transfer from gas bubble to liquid is proportional to the concentration gradient across the gas-liquid interface.

OTR Equation:
$OTR = k_{L} a \cdot (C^{*} - C_{L})$

$k_{L} a$ : Volumetric mass transfer coefficient ( $h^{-1}$ ). Incorporates the liquid film coefficient ( $k_{L}$ ) and the interfacial area ( $a$ ). This is a key parameter influenced by mixing speed and aeration rate.
$C^{*}$ : Saturation dissolved oxygen (DO) concentration (in equilibrium with gas phase).
$C_{L}$ : Actual DO concentration in the bulk liquid.

4.3 Bioreactor Operation Modes

Mode	Description	Advantages	Disadvantages
Batch	All nutrients added initially; nothing added/removed during run.	Simple, low contamination risk.	Downtime between batches; substrate inhibition possible.
Fed-Batch	Nutrients (often substrate) added incrementally during run.	High cell density; avoids inhibition; product formation often enhanced. Most common industrial mode.	Requires feeding strategy control.
Continuous (Chemostat)	Fresh medium continuously added; spent culture continuously removed at same rate.	High productivity; steady-state operation.	Contamination risk; strain stability issues (mutation).

The Chemostat (Continuous Culture) :
At steady state, the growth rate ( $μ$ ) is controlled by and equals the dilution rate ( $D$ ).
$D = V F = μ$
Where $F$ is the feed flow rate and $V$ is the reactor volume. This powerful tool allows the study of cells at specific growth rates.

5. Downstream Processing (DSP)

The goal of DSP is to recover and purify the product from the complex fermentation broth efficiently and economically, which often dominates the total production cost .

Typical Downstream Sequence:

Removal of Insolubles (Harvesting):
- Centrifugation: Separates cells/cell debris from liquid based on density differences .
- Filtration: Microfiltration for cell separation; ultrafiltration for concentration.
Cell Disruption (for intracellular products): Homogenization (high-pressure), bead milling, or sonication .
Primary Isolation (Capture):
- Precipitation: Salting out (ammonium sulfate) or solvent precipitation.
- Extraction: Liquid-liquid extraction (e.g., aqueous two-phase systems).
Purification (Polishing):
- Chromatography: The highest resolution method .
  - Ion Exchange (IEX): Separates based on surface charge.
  - Affinity: Uses specific binding (e.g., Protein A for antibodies).
  - Size Exclusion (SEC): Separates by molecular size/shape.
Formulation: Concentration, diafiltration, drying (freeze-drying/spray drying), and sterile filling.

Key Terminology Glossary

Term	Definition
Biocatalysis	The use of enzymes or whole cells as catalysts for chemical reactions.
Bioreactor	A vessel designed to support a biological reaction (fermentation, cell culture).
Cell Disruption	The process of breaking open cells to release intracellular products.
Chemostat	A continuous culture device where the growth rate is controlled by the dilution rate.
Downstream Processing	All stages of product recovery and purification after the bioreaction.
Fermentation	The process of growing microorganisms under controlled conditions (often implies anaerobic, but commonly used for all microbial culture).
Fed-Batch Culture	An operational technique where nutrients are fed incrementally during the culture run.
Immobilization	The technique of attaching enzymes or cells to a solid support for reusability.
Inoculum	The population of cells used to start a culture in a bioreactor.
$K_{m}$ (Michaelis Constant)	Substrate concentration at half the maximum reaction rate ( $v_{ma x}$ ); measure of affinity.
$K_{s}$ (Monod Constant)	Substrate concentration at half the maximum specific growth rate ( $μ_{ma x}$ ).
Mass Transfer	The net movement of a component (e.g., oxygen) from one phase to another.
Scale-up	The process of transferring a bioprocess from laboratory to commercial scale.
Sterilization	The complete elimination of all living microorganisms and viruses.
Upstream Processing	All stages from raw material handling to inoculation of the bioreactor.
$v_{ma x}$	The maximum rate of an enzyme-catalyzed reaction when the enzyme is saturated with substrate.

Self-Test Questions

Compare and contrast the three main modes of bioreactor operation (batch, fed-batch, chemostat). For which mode does $D = μ$ at steady state?
Write the Michaelis-Menten equation and define $v_{ma x}$ and $K_{m}$ . How would a competitive inhibitor alter these parameters?
Explain why oxygen transfer ( $k_{L} a$ ) is often the rate-limiting step in aerobic fermentation processes.
Describe the Monod equation and its significance in modeling microbial growth.
Why is enzyme immobilization important? Name two methods of immobilization and list one advantage and one disadvantage for each.
A fermentation broth contains E. coli cells expressing an intracellular protein product. Outline a downstream processing train to recover and purify this protein.

BTH-4211: INDUSTRIAL BIOTECHNOLOGY – Complete Study Notes

This comprehensive guide covers the application of biotechnology in industrial processes, including microbial fermentation, enzyme technology, production of biofuels, biochemicals, pharmaceuticals, and waste treatment. These notes are designed for undergraduate and graduate students of biotechnology, biochemical engineering, and industrial microbiology.

PART 1: INTRODUCTION TO INDUSTRIAL BIOTECHNOLOGY

1.1 Definition and Scope

Definition: Industrial biotechnology (also known as white biotechnology) is the application of biological systems (microorganisms, plant cells, animal cells, enzymes) for the production of industrially useful products and processes. It harnesses cellular machinery to convert renewable feedstocks into chemicals, materials, fuels, and pharmaceuticals under mild conditions.

Comparison with Traditional Chemical Industry:

Aspect	Chemical Industry	Industrial Biotechnology
Feedstock	Fossil fuels (petroleum, natural gas, coal)	Renewable biomass (corn, sugarcane, lignocellulose)
Reaction conditions	High temperature, high pressure, toxic catalysts	Ambient temperature, atmospheric pressure, biocompatible pH
Energy consumption	High	Low
Waste generation	High (toxic byproducts)	Low (biodegradable waste)
Specificity	Poor (multiple byproducts)	High (enzymes are specific)
Product yield	High	Moderate
Production rate	Fast	Slow (microbial growth time)

1.2 Historical Development

Era	Development	Impact
6000 BCE	Fermentation (beer, wine, bread)	First use of microbes
500 BCE	Cheese, yogurt production	Lactic acid bacteria
1857	Pasteur’s work on fermentation	Germ theory; microbial metabolism
1897	Buchner’s cell-free fermentation	Enzymes can function outside cells
1914-1918	Acetone-butanol fermentation (Weizmann)	Industrial solvents from starch
1940s	Penicillin production (WWII)	Large-scale antibiotic fermentation
1950s	Glutamic acid fermentation (Japanese MSG)	Amino acids from fermentation
1970s	Single-cell protein (SCP)	Protein from petroleum or methanol
1980s	Recombinant DNA technology	Insulin, growth hormone, interferon in microbes
1990s	Bioplastics (PHB from Ralstonia)	Renewable plastics
2000s-present	Biofuels (ethanol, biodiesel, butanol); metabolic engineering; synthetic biology	Renewable energy; designer microbes

1.3 Major Products of Industrial Biotechnology

Category	Products	Microorganisms/Enzymes
Bulk chemicals	Ethanol, butanol, acetone, acetic acid, lactic acid, citric acid	Yeast (S. cerevisiae), Clostridium, Aspergillus niger
Amino acids	Glutamic acid (MSG), lysine, methionine, threonine	Corynebacterium glutamicum, E. coli
Organic acids	Citric acid, lactic acid, succinic acid, itaconic acid	A. niger, Lactobacillus, E. coli
Antibiotics	Penicillin, cephalosporin, tetracycline, erythromycin	Penicillium chrysogenum, Streptomyces
Vitamins	Vitamin B₂ (riboflavin), B₁₂ (cobalamin), C (ascorbic acid)	Ashbya gossypii, Propionibacterium, Gluconobacter
Enzymes	Proteases, amylases, lipases, cellulases, xylanases, phytase	Bacillus, Aspergillus, Trichoderma
Biopolymers	Polyhydroxyalkanoates (PHA), polylactic acid (PLA)	Ralstonia eutropha, engineered E. coli
Biofuels	Ethanol (first generation), cellulosic ethanol (second generation), biodiesel, biobutanol, biogas (methane)	Zymomonas mobilis, engineered yeast, algae, methanogens
Pharmaceuticals	Insulin, human growth hormone, interferon, vaccines, monoclonal antibodies	E. coli, yeast (Pichia pastoris), CHO cells

PART 2: MICROBIAL FERMENTATION

2.1 Fermentation Types

Based on Oxygen Requirement:

Type	Definition	Examples
Aerobic fermentation	Requires oxygen (O₂ as terminal electron acceptor in respiration)	Citric acid (Aspergillus niger), antibiotics (Penicillium, Streptomyces), single-cell protein
Anaerobic fermentation	No oxygen; organic compounds as electron acceptors (substrate-level phosphorylation; no TCA cycle or ETC in strict anaerobes)	Ethanol (yeast), lactic acid (Lactobacillus), butanol (Clostridium)
Facultative anaerobic	Can grow with or without oxygen (switch between respiration and fermentation)	E. coli (mixed-acid fermentation); Saccharomyces cerevisiae (Crabtree effect: ferments even in presence of oxygen when glucose high)

Based on Fermentation Mode:

Mode	Description	Advantages	Disadvantages	Examples
Batch fermentation	All nutrients added at start; no addition or removal until end	Simple; low contamination risk	Low productivity; downtime between batches	Penicillin, ethanol (traditional)
Fed-batch fermentation	Nutrients added intermittently; product removed at end	Higher yield; avoids inhibition; extends production phase	More complex control	Most industrial fermentations (antibiotics, amino acids)
Continuous fermentation (chemostat)	Nutrients continuously added; product and cells continuously removed	High productivity; steady state; automated	Contamination risk; strain degeneration	Wastewater treatment (activated sludge); research; some industrial (baker’s yeast)
Perfusion culture	Cells retained; medium flows through	High cell density; high productivity	Complex; fouling	Mammalian cell culture (monoclonal antibodies)

2.2 Fermentation Medium

Components of Fermentation Medium:

Component	Purpose	Examples	Typical Concentration
Carbon source	Energy; building blocks	Glucose, sucrose, molasses, starch, corn steep liquor, lignocellulosic hydrolysates	20-150 g/L
Nitrogen source	Amino acids; nucleotides; biosynthesis	Ammonium salts (NH₄Cl, (NH₄)₂SO₄), urea, yeast extract, peptone, corn steep liquor, soybean meal	2-10 g/L (N equivalent)
Phosphorus source	ATP; nucleic acids; phospholipids	KH₂PO₄, K₂HPO₄ (buffer)	0.5-2 g/L
Sulfur source	Cysteine; methionine; cofactors	MgSO₄·7H₂O, Na₂SO₄, (NH₄)₂SO₄	0.2-1 g/L
Metal ions	Enzyme cofactors; protein stabilization	Mg²⁺ (0.5-2 mM), Mn²⁺, Fe²⁺, Zn²⁺, Ca²⁺, Co²⁺, Cu²⁺, MoO₄²⁻	Trace (μM)
Vitamins	Enzyme cofactors	Biotin, thiamine (B₁), riboflavin (B₂), nicotinic acid (B₃), pyridoxine (B₆), pantothenic acid (B₅), folic acid, cobalamin (B₁₂)	μg/L
Buffers	Maintain pH	K₂HPO₄/KH₂PO₄, CaCO₃ (neutralizes acids)	10-50 mM
Antifoam	Prevent foaming	Silicone oil, polypropylene glycol	0.1-1 mL/L
Inducer	Trigger gene expression	IPTG (lac operon), lactose, methanol (AOX1 promoter in Pichia)	Variable
Precursors	Incorporate into product	Phenylacetic acid (penicillin G), lysine (cephalosporin)	Variable

Complex vs. Defined Media:

Feature	Complex Media	Defined (Synthetic) Media
Composition	Unknown; from natural sources (yeast extract, peptone, corn steep liquor)	Known; each chemical component defined (glucose, NH₄Cl, salts)
Cost	Low	High
Reproducibility	Batch-to-batch variation	High
Growth rate	Fast (contains growth factors)	Slower (requires biosynthesis of metabolites)
Product recovery	May contain contaminants affecting purity	Easier downstream processing
Examples	LB (Luria-Bertani) broth, YPD (yeast extract-peptone-dextrose)	M9 minimal medium

2.3 Fermenter (Bioreactor) Design

Types of Bioreactors:

Type	Agitation	Aeration	Mixing	Applications
Stirred-tank reactor (STR)	Impellers (Rushton turbine, marine propeller, pitched-blade)	Sparger (ring, porous, drilled pipe)	Good	Most microbial fermentations (aerobic)
Air-lift reactor	No moving parts (fluid circulation by gas injection)	Sparger at bottom	Gentle (low shear)	Shear-sensitive cells (plant cells, mammalian cells, algae)
Bubble column	No agitation (gas bubbles only)	Sparger at bottom	Poor	Wastewater treatment; simple fermentations
Packed-bed reactor	No agitation	Flow through packed bed	Plug flow	Immobilized cells/enzymes; solid-state fermentation (koji)
Fluidized-bed reactor	Fluid flow suspends particles	Upward flow	Good (medium shear)	Immobilized enzymes; cells on beads
Photobioreactor	Light exposure	CO₂ sparging	Variable	Algae (biofuels, nutraceuticals)

Components of a Stirred-Tank Bioreactor:

Component	Function
Vessel	Contains culture (jacketed for temperature control; glass or stainless steel)
Impeller(s)	Mixing; gas dispersion; heat transfer (Rushton turbines for shear; marine propellers for low shear)
Baffles	Prevent vortex; improve mixing
Sparger	Supplies air/oxygen (ring sparger; porous sparger for fine bubbles)
Temperature probe	Measure temperature; PID controller with heating/cooling (jacket or internal coils)
pH probe	Measure pH; controller adds acid or base
Dissolved oxygen (DO) probe	Measure O₂ concentration; DO-stat or cascade control (increase agitation, aeration, or pure O₂)
Foam sensor	Detect foam; add antifoam
Exhaust gas analyzer	Monitor O₂ and CO₂ in off-gas (O₂ consumption rate, OUR; CO₂ evolution rate, CER)
Sampling port	Aseptic sample collection
Inoculation port	Aseptic addition of inoculum
Viewing window	Visual inspection

2.4 Fermentation Parameters and Control

Critical Parameters:

Parameter	Optimum Range (Typical)	Monitoring	Control
Temperature	25-37°C (mesophiles); 50-60°C (thermophiles)	Thermocouple, RTD	Jacket (hot/cold water); heating/cooling coils
pH	5.5-7.5 (most microbes)	pH probe (sterilizable)	Acid (HCl, H₂SO₄) or base (NaOH, NH₄OH) pumps
Dissolved oxygen (DO)	>20-30% of air saturation	DO probe (polarographic or optical)	Agitation speed; aeration rate; O₂ enrichment
Agitation speed	50-1000 rpm	Tachometer	Motor speed control (inverter)
Aeration rate	0.5-2 vvm (volume air/volume medium/minute)	Mass flow meter	Rotameter; mass flow controller
Pressure	0.2-0.5 bar (above atmospheric)	Pressure gauge	Back-pressure regulator (sparger; exhaust valve)
Foam	Variable	Foam (conductivity) sensor	Antifoam addition pump; mechanical foam breaker
Redox potential (ORP)	Variable (aerobic vs. anaerobic)	Redox probe	Agitation; aeration; reducing agents
CO₂ evolution rate (CER)	Variable (metabolic activity)	Exhaust CO₂ analyzer	Feed rate control (CER-stat)
Oxygen uptake rate (OUR)	Variable	Exhaust O₂ analyzer + inlet O₂	Feed rate control; DO-stat

Scale-Up Considerations (from lab to pilot to industrial scale):

Parameter	Constant	Challenges
Volumetric oxygen transfer coefficient (kLa)	Maintain kLa	Larger reactors have lower surface area-to-volume ratio; need more sparger holes and higher agitation power
Tip speed	Maintain impeller tip speed	Shear stress may damage cells (animal cells, filamentous fungi) at larger scale if constant tip speed maintained
Power per volume (P/V)	Maintain P/V (watt/m³)	Mixing time increases (dead zones); oxygen transfer limitations at large scale
Reynolds number	Maintain turbulent flow (Re > 10⁴)	Usually achieved; mixing time still increases
Residence time distribution	Maintain plug flow or perfectly mixed	Often changes (short-circuiting; dead zones) at large scale; need tracer studies

PART 3: ENZYME TECHNOLOGY

3.1 Sources of Industrial Enzymes

Source	Examples	Advantages	Disadvantages
Microorganisms	Bacillus (proteases, amylases); Aspergillus (amylases, cellulases, xylanases, pectinases); Trichoderma (cellulases); Kluyveromyces (lactase)	Easy cultivation; high yield; genetic manipulation; wide range of conditions	Potential pathogenicity (some strains)
Animals	Rennet (chymosin from calf stomach); pancreatic enzymes (trypsin, chymotrypsin, lipase)	Naturally evolved for specific substrates	High cost; limited supply; ethical concerns (slaughter)
Plants	Papain (papaya); bromelain (pineapple); ficin (fig); actinidin (kiwi)	Renewable; easily extracted	Low yield; seasonal availability; limited range

3.2 Types of Industrial Enzymes

Enzyme	Source	Reaction	Applications
Amylase (α-amylase)	Bacillus licheniformis, Aspergillus oryzae	Hydrolyzes α(1→4) glycosidic bonds in starch (endo-amylase)	Starch liquefaction (ethanol, glucose syrup); desizing textiles; detergents
Glucoamylase (amyloglucosidase)	Aspergillus niger	Hydrolyzes α(1→4) and α(1→6) linkages from non-reducing end (exo)	Starch saccharification (glucose syrup)
Pullulanase	Bacillus acidopullulyticus, Klebsiella	Hydrolyzes α(1→6) branch points in amylopectin and pullulan	High-glucose syrup (combined with glucoamylase)
Protease (alkaline)	Bacillus licheniformis, B. subtilis	Hydrolyzes peptide bonds (endo-protease)	Detergents (removes protein stains); leather unhairing; food processing
Lipase	Candida antarctica, Thermomyces lanuginosus, Aspergillus niger	Hydrolyzes triglycerides to glycerol + fatty acids; also catalyzes esterification, transesterification	Detergents (removes oil stains); biodiesel (transesterification); dairy (flavor development)
Cellulase	Trichoderma reesei, Aspergillus niger	Hydrolyzes cellulose to glucose (β(1→4) linkages)	Cellulosic ethanol; textile finishing (stonewashed jeans); detergents; animal feed
Xylanase	Trichoderma reesei, Aspergillus niger	Hydrolyzes xylan (hemicellulose) to xylose	Pulp bleaching (paper industry); animal feed (wheat-based)
Pectinase	Aspergillus niger	Hydrolyzes pectin (α(1→4) galacturonic acid)	Fruit juice clarification; wine making; textile degumming
Lactase (β-galactosidase)	Kluyveromyces lactis, Aspergillus oryzae	Hydrolyzes lactose → glucose + galactose	Lactose-free milk; whey processing
Glucose oxidase	Aspergillus niger	Glucose + O₂ → gluconic acid + H₂O₂	Food preservation (oxygen removal); biosensors
Catalase	Aspergillus niger, bovine liver	2H₂O₂ → 2H₂O + O₂	Remove H₂O₂ after bleaching (textiles, paper)
Phytase	Aspergillus niger, E. coli	Hydrolyzes phytate (inositol hexaphosphate) to phosphate	Animal feed (reduces phosphate pollution)
Rennet (chymosin)	Calf stomach; recombinant E. coli (chymosin)	Cleaves κ-casein → coagulates milk	Cheese making

3.3 Enzyme Immobilization

Definition: Confining enzyme molecules to a solid support (matrix, membrane, bead) to enable reuse, continuous operation, and improved stability.

Methods of Immobilization:

Method	Type of Bond	Reversibility	Advantages	Disadvantages	Examples
Adsorption	Physical (van der Waals, H-bonds, hydrophobic)	Reversible	Simple; mild conditions; no chemical modification	Leaching (weak bond); low loading	Lipase on hydrophobic resin (biodiesel)
Covalent bonding	Chemical (amide, thiol, ether)	Irreversible	Strong bond; no leaching	Chemical modification may denature enzyme	Amino groups of lysine to CNBr-activated Sepharose
Entrapment	Physical (polymer network, sol-gel)	Irreversible	Mild conditions; protects enzyme	Substrate diffusion limitation; leakage of small enzymes	Alginate beads; polyacrylamide gel
Encapsulation	Physical (semipermeable membrane)	Irreversible	Protects from large molecules	Diffusion limitation	Liposome-encapsulated enzymes; hollow fiber reactors
Cross-linking	Chemical (between enzyme molecules)	Irreversible	No carrier needed (enzyme aggregates, CLEAs)	Aggregation may reduce activity	Cross-linked enzyme aggregates (CLEAs); cross-linked crystals (CLECs)

Immobilization Supports:

Support	Material	Pore size	Applications
Beads	Agarose (Sepharose), alginate, chitosan, polyacrylamide, polystyrene	50-200 μm diameter	Column reactors (packed-bed)
Membranes	Cellulose acetate, polyethersulfone, nylon	0.1-1 μm pores	Membrane reactors; ultrafiltration
Non-porous particles	Glass, silica, magnetic beads (Fe₃O₄)	Non-porous (surface only)	Fluidized-bed reactors; magnetic separation
Fibers	Nylon, cellulose	—	Packed-bed reactors
Sol-gel	Silica (tetraethyl orthosilicate, TEOS)	Mesoporous (2-50 nm)	Biocatalysis in organic solvents

Advantages of Immobilized Enzymes:

Advantage	Explanation
Reusability	Can be recovered and reused (reduces enzyme cost)
Continuous operation	Packed-bed or fluidized-bed reactors for continuous production
Increased stability	Immobilization often increases thermal and pH stability; protects from denaturation
Easier product separation	Enzyme not in product stream (reduces downstream processing)
Controlled microenvironment	Can modify support to optimize pH, ionic strength near enzyme

PART 4: BIOFUELS

4.1 First-Generation Biofuels (from food crops)

Biofuel	Feedstock	Process	Yield	Advantages	Disadvantages
Ethanol	Corn (US), sugarcane (Brazil), wheat (EU), sugar beet, sorghum	Sugar fermentation (yeast S. cerevisiae) after hydrolysis (starch to glucose)	2.5-3.5 gallons/bushel corn; 80-100 L/ton sugarcane	Well-established technology	Food vs. fuel; land use change; water consumption
Biodiesel	Vegetable oils (soybean, rapeseed, palm, sunflower), animal fats, used cooking oil	Transesterification (oil + methanol → biodiesel + glycerol) with base catalyst (NaOH, KOH) or enzyme (lipase)	1000 L oil → 1000 L biodiesel + 100 L glycerol	Renewable; biodegradable	Feedstock cost; glycerol byproduct
Biogas (methane)	Organic waste (manure, agricultural residue, food waste, sewage sludge)	Anaerobic digestion (hydrolysis → acidogenesis → acetogenesis → methanogenesis) by microbial consortia	0.5-1 m³ biogas/kg volatile solids (60-70% CH₄)	Waste treatment + energy; versatile feedstock	Low energy density (biogas); impurities (H₂S, CO₂)

4.2 Second-Generation Biofuels (from lignocellulosic biomass)

Feedstocks:

Agricultural residues: Corn stover (stalks, leaves), wheat straw, rice straw, sugarcane bagasse
Forestry residues: Wood chips, sawdust, bark
Energy crops: Switchgrass, miscanthus, poplar, willow
Municipal solid waste (cellulosic fraction)

Lignocellulosic Biomass Composition:

Component	Percentage	Polymer	Monomer	Linkage
Cellulose	35-50%	Linear β(1→4) glucose	D-glucose	β(1→4)
Hemicellulose	20-35%	Branched polysaccharides (xylose, arabinose, mannose, galactose, glucose)	D-xylose (main in hardwoods and grasses), L-arabinose, D-mannose, D-galactose, D-glucose	β(1→4) (xylose backbone) with arabinose, glucuronic acid branches
Lignin	15-25%	Complex aromatic polymer (p-coumaryl alcohol, coniferyl alcohol, sinapyl alcohol)	Phenylpropanoid units (C9)	C-O-C (ether) and C-C bonds (highly recalcitrant)

Lignocellulosic Ethanol Production Process:

Challenges for Lignocellulosic Ethanol:

Challenge	Explanation
Recalcitrance	Lignin is hard to break down; requires energy-intensive pretreatment
Enzyme cost	Cellulases and hemicellulases are expensive (20-50 cents/gallon ethanol)
Mixed sugars	S. cerevisiae does not naturally ferment xylose (requires engineering; e.g., xylose isomerase pathway or oxidoreductive pathway)
Inhibitors	Pretreatment releases inhibitors (furfural from pentose dehydration; HMF from hexose dehydration; acetic acid from hemicellulose; phenolic compounds from lignin)
Lignin valorization	Lignin is underutilized (currently mostly burned for heat; needs higher-value products for economic viability)

4.3 Third-Generation Biofuels (from algae)

Advantages of Algae:

Advantage	Explanation
High productivity	10-100 times higher oil yield per hectare than oilseeds (soybean, palm)
No arable land	Can grow in brackish water, wastewater, or seawater; on non-arable land
CO₂ sequestration	Can utilize flue gas CO₂ from power plants
No food competition	Does not compete with food crops
Co-products	Proteins for animal feed; carbohydrates for fermentation; nutraceuticals (astaxanthin, β-carotene, omega-3s)

Algal Biofuels Production Pathway:

Step	Process
1. Cultivation	Open ponds (raceway ponds; low cost; contamination risk) or photobioreactors (PBR; closed; higher cost; higher productivity)
2. Harvesting	Flocculation (alum, chitosan); centrifugation; filtration; flotation
3. Oil extraction	Mechanical (expeller press); solvent (hexane); supercritical CO₂; enzymatic
4. Transesterification	Convert extracted oil to biodiesel (lipase or chemical catalyst)
5. Whole algae conversion	Hydrothermal liquefaction (HTL) – converts wet algae to bio-crude (no oil extraction needed)

4.4 Biobutanol (ABE Fermentation)

Process: Acetone-Butanol-Ethanol (ABE) fermentation by Clostridium acetobutylicum, C. beijerinckii, C. saccharoperbutylacetonicum

Product	Ratio (ABE)	Properties
Acetone	3	Solvent; chemical intermediate
Butanol	6	Biofuel (higher energy density than ethanol; less corrosive; less hygroscopic)
Ethanol	1	Biofuel

Advantages of Biobutanol:

Energy density: 29.2 MJ/L (ethanol: 21.2 MJ/L; gasoline: 32.5 MJ/L)
Less volatile; lower vapor pressure
Less corrosive (can use existing pipelines)
Can be blended with gasoline at higher concentrations

Challenges:

Low yield (0.25-0.35 g butanol/g glucose) due to metabolic limits and toxicity (butanol inhibits Clostridium at ~15 g/L)
Product inhibition (butanol toxicity)
Strain degeneration (loss of solventogenesis after repeated subculture)

PART 5: PRODUCTION OF INDUSTRIAL PRODUCTS

5.1 Amino Acids (Glutamic Acid – MSG)

Microorganism: Corynebacterium glutamicum (also Brevibacterium flavum, B. lactofermentum)

Feature	Description
Feedstock	Molasses (sucrose), glucose, starch hydrolysate, beet molasses, cane molasses
Biotin limitation	Biotin required for growth; biotin limitation causes cell membrane changes → efflux of glutamate (leaky membrane)
Tween 40/Tween 60	Surfactants (cause membrane permeability; glutamate efflux)
Penicillin addition	Inhibits cell wall synthesis → membrane leakage → glutamate release
Yield	150-200 g/L; 50-60% conversion (from sugar)
Recovery	Crystallization (isoelectric point: pI of glutamic acid is ~3.2)

Metabolic Engineering for Glutamate Production:

Modification	Effect
Pyruvate carboxylase (pyc) overexpression	Increases oxaloacetate (TCA cycle intermediate)
Glutamate dehydrogenase (gdh) overexpression	Increases conversion of α-ketoglutarate to glutamate
2-oxoglutarate dehydrogenase (odhA) knockout	Blocks TCA cycle at α-ketoglutarate; accumulates glutamate precursor
Biotin auxotrophy	Control biotin in medium (low biotin for production phase)

5.2 Antibiotics (Penicillin G, V, Cephalosporin)

Penicillin (Penicillium chrysogenum):

Parameter	Details
Fermentation type	Aerobic; fed-batch (300-500 m³ vessels)
Feedstock	Corn steep liquor (nitrogen source; contains precursors), lactose (slowly metabolized carbon source; avoids repression), glucose (limited to prevent catabolite repression)
pH	6.5-7.0
Temperature	24-28°C
Agitation/aeration	High oxygen demand (O₂ transfer rate critical)
Precursors	Phenylacetic acid (penicillin G); phenoxyacetic acid (penicillin V) (added to fermentation)
Yield	50-70 g/L (modern industrial strains)
Recovery	Filter mycelium (discard); extract penicillin from broth with organic solvent (butyl acetate) at low pH; back-extract with buffer; crystallize

Cephalosporin (Cephalosporium acremonium, now Acremonium chrysogenum; also Streptomyces clavuligerus for cephamycin C):

Parameter	Details
Precursors	L-α-aminoadipic acid, L-cysteine, L-valine (ACV tripeptide)
Enzymes	ACV synthetase (non-ribosomal peptide synthetase, NRPS); isopenicillin N synthase (IPNS); expandase (deacetoxycephalosporin C synthase, DAOCS); hydroxylase (deacetylcephalosporin C synthase, DACHS)
Yield	10-20 g/L

5.3 Bioplastics (Polyhydroxyalkanoates, PHA)

Type	Monomer	Properties	Applications
PHB (poly-3-hydroxybutyrate)	3-hydroxybutyrate	Brittle; stiff; high crystallinity	Packaging; compostable bags
PHBV (copolymer with 3-hydroxyvalerate)	3-hydroxybutyrate + 3-hydroxyvalerate	More flexible; less crystalline	Films; bottles
PHA copolymers with medium-chain-length (mcl-PHA)	C6-C14 monomers	Elastomeric; flexible	Medical devices; drug delivery

Production Organisms:

Organism	Carbon source	PHA type	Yield
Cupriavidus necator (formerly Ralstonia eutropha)	Glucose, fructose, plant oils	PHB (scl-PHA)	60-80% dry cell weight (with nutrient limitation)
Pseudomonas putida	Fatty acids, glucose	mcl-PHA	30-50% DCW
E. coli (engineered)	Glucose	PHB, PHBV	40-70% DCW

Fermentation Strategy for PHB:

Phase	Condition	Purpose
Growth phase	Excess nutrients (balanced growth)	Increase cell mass
Production phase	Nitrogen or phosphate limitation; excess carbon	Accumulate PHB (stress response; carbon storage)

PART 6: DOWNSTREAM PROCESSING

6.1 Overview of Downstream Processing Steps

Step	Purpose	Methods
1. Harvest (cell separation)	Separate cells (biomass) from broth	Filtration, centrifugation, sedimentation
2. Cell disruption	Break open cells to release intracellular products	Mechanical (bead mill, homogenizer), chemical (detergents, solvents), enzymatic (lysozyme), physical (ultrasonication, freeze-thaw)
3. Primary recovery	Remove cell debris; concentrate product	Centrifugation, microfiltration, ultrafiltration, precipitation
4. Purification	Remove impurities	Chromatography (affinity, ion exchange, size exclusion, hydrophobic interaction), two-phase extraction, precipitation, crystallization
5. Formulation	Prepare final product (liquid, powder, solid)	Drying (spray drying, freeze drying/lyophilization), crystallization, tableting

6.2 Cell Separation Methods

Method	Principle	Scale	Advantages	Disadvantages
Centrifugation	Density difference (sedimentation under centrifugal force)	Pilot to industrial	Continuous (disc-stack centrifuge); handles large volumes	High energy; shear stress may damage cells
Microfiltration	Membrane (0.1-1 μm pores); cells retained, broth passes	Laboratory to industrial	Gentle; no shear; continuous	Fouling; membrane replacement cost
Flocculation	Aggregates cells with polymers (alum, chitosan, polyelectrolytes)	Industrial	Low cost; enhances settling	May contaminate product
Sedimentation	Gravity settling	Large industrial (wastewater)	Low cost	Very slow; large footprint

6.3 Cell Disruption Methods

Method	Principle	Scale	Suitable for	Advantages	Disadvantages
Bead mill	Agitation with glass/ceramic/zirconia beads (shear and impact)	Laboratory to industrial	Bacteria, yeast, fungi	High efficiency; scalable	Heat generation (cooling required); bead wear
High-pressure homogenizer (French press, Microfluidizer)	Cell suspension forced through small orifice (high shear; pressure drop)	Laboratory to industrial	Bacteria, yeast	Continuous; high efficiency	Heat generation; multiple passes needed for tough cells
Ultrasonication	High-frequency sound waves (cavitation)	Laboratory

BTH-4232 Nanobiotechnology – Comprehensive Study Notes

These notes cover the fundamental principles and applications of nanobiotechnology, the interdisciplinary field at the intersection of nanotechnology and biology. The material is suitable for undergraduate and graduate students in biotechnology, nanoscience, bioengineering, and related fields.

Part 1: Foundations of Nanobiotechnology

1.1 What is Nanobiotechnology?

Nanobiotechnology is the application of nanotechnology (the design, characterization, production, and application of structures, devices, and systems by controlling shape and size at the nanometer scale) to biological systems. It encompasses both the use of biological molecules to create nanoscale devices and the application of nanomaterials to biological problems.

Key Definitions:

Nanotechnology: The manipulation of matter at the scale of 1-100 nanometers
Nanoscience: The study of phenomena and manipulation of materials at the nanoscale
Nanobiotechnology: The intersection of nanotechnology and biology; the application of nanoscale principles to biological systems

Why Nanoscale Matters (1-100 nm):

Quantum effects become significant (size-dependent optical, electronic, magnetic properties)
Surface area to volume ratio increases dramatically (affects reactivity, solubility, binding)
Comparable size to biological molecules (proteins ~5-10 nm, DNA ~2 nm diameter, viruses ~20-300 nm, cell membrane thickness ~5-10 nm)

1.2 Historical Development

Year	Development	Scientists/Institution
1959	“There’s Plenty of Room at the Bottom” lecture (concept of nanotechnology)	Richard Feynman
1974	Coined term “nanotechnology”	Norio Taniguchi
1981	Scanning Tunneling Microscope (STM) invented	Gerd Binnig & Heinrich Rohrer (IBM)
1985	Buckminsterfullerene (C₆₀) discovered	Kroto, Curl, Smalley (Nobel 1996)
1986	Atomic Force Microscope (AFM) invented	Binnig, Quate, Gerber
1989	“IBM” written with 35 xenon atoms (STM manipulation)	Don Eigler (IBM)
1991	Carbon nanotubes discovered	Sumio Iijima
2000s	Nanoparticles for drug delivery (Doxil approved 1995)	FDA approvals
2010s	CRISPR-Cas9 + nanoparticle delivery; mRNA lipid nanoparticles (COVID-19 vaccines)	Various

1.3 Top-Down vs. Bottom-Up Approaches

Approach	Description	Advantages	Limitations	Examples
Top-down	Start with bulk material; remove material to create nanoscale features	High precision; established semiconductor methods	Expensive equipment; material waste; surface defects	Photolithography, electron beam lithography, ball milling
Bottom-up	Build nanoscale structures atom-by-atom or molecule-by-molecule	Less waste; can create complex structures; self-assembly	Slower; challenging to control precisely	Self-assembly, DNA origami, chemical synthesis of nanoparticles

1.4 Self-Assembly

Definition: Spontaneous organization of molecules into ordered structures without external direction.

Types of Self-Assembly:

Type	Description	Examples
Static self-assembly	System at equilibrium; structures do not dissipate energy	Lipid bilayers, DNA hybridization, protein folding
Dynamic self-assembly	Requires energy input; non-equilibrium structures	Cytoskeleton dynamics, bacterial colonies
Templated self-assembly	Use of template to guide assembly	DNA origami (scaffold + staple strands), protein cages

Examples in Nanobiotechnology:

Lipid bilayers – Amphiphilic lipids spontaneously form bilayers (cell membrane models; liposomes for drug delivery)
DNA hybridization – Complementary base pairing; used in DNA origami and nanostructures
Protein self-assembly – Viral capsids; ferritin (iron storage); designed protein cages

Part 2: Characterization Tools

2.1 Electron Microscopy

Technique	Resolution	Working Principle	Sample Requirements	Information Obtained
Scanning Electron Microscopy (SEM)	1-10 nm	Scan electron beam; detect secondary electrons	Conductive coating (Au, Pt) or low voltage; vacuum	Surface topography (3D appearance)
Transmission Electron Microscopy (TEM)	0.1-1 nm	Electrons transmitted through thin sample	Very thin (<100 nm); heavy metal staining (uranyl acetate, osmium)	Internal structure; nanoparticle size/shape
Cryo-EM	0.2-0.5 nm (near-atomic)	Sample frozen in vitreous ice; avoids staining artifacts	Rapid freezing; no staining	High-resolution structure of proteins, viruses, nanoparticles

2.2 Scanning Probe Microscopy

Technique	Resolution	Working Principle	Sample Requirements	Information Obtained
Atomic Force Microscopy (AFM)	Atomic (0.1 nm lateral)	Cantilever with sharp tip scans surface; measures deflection (contact/tapping mode)	Any surface (conductive or non-conductive); can operate in liquid	Surface topography; mechanical properties; force measurements
Scanning Tunneling Microscopy (STM)	Atomic	Conducting tip; tunneling current between tip and conductive surface	Conductive surface; vacuum or liquid	Atomic-scale topography; electronic structure

AFM Modes:

Mode	Description	Advantages	Applications
Contact mode	Tip in constant contact; cantilever deflection feedback	High resolution; stable	Hard surfaces; imaging in air
Tapping mode (intermittent contact)	Tip oscillates; touches sample intermittently	Reduces lateral forces; gentler on soft samples	Soft biological samples (cells, proteins)
PeakForce Tapping	Force-curve-based imaging; peak force feedback	Very gentle; high resolution	Live cells; fragile biomolecules
Force spectroscopy	Measure force vs. distance (approach-retract curves)	Quantifies binding forces	Ligand-receptor binding; protein unfolding

2.3 Dynamic Light Scattering (DLS)

Principle: Measures Brownian motion of nanoparticles by analyzing fluctuations in scattered light intensity; uses Stokes-Einstein equation to calculate hydrodynamic diameter.

Stokes-Einstein Equation: d = kT / (3πηD)

where d = hydrodynamic diameter, k = Boltzmann constant, T = temperature, η = viscosity, D = diffusion coefficient

Information Obtained:

Hydrodynamic diameter (size)
Polydispersity index (PDI) – width of size distribution
Zeta potential (electrophoretic light scattering) – surface charge

Limitations: Cannot resolve complex shapes (assumes spherical); limited to <1 μm; requires refractive index matching

2.4 Zeta Potential Measurement

Definition: Electrokinetic potential at the slipping plane (shear plane) of a particle; measures surface charge.

Interpretation:

Zeta Potential (mV)	Stability
0 to ±5	Rapid coagulation/flocculation
±10 to ±20	Unstable
±20 to ±30	Moderately stable
±30 to ±40	Good stability
>±40	Excellent stability

Significance: High magnitude (positive or negative) → electrostatic repulsion → stable colloidal suspension (prevents aggregation).

2.5 Other Characterization Techniques

Technique	Principle	Information Obtained
UV-Vis spectroscopy	Absorption of UV-visible light by nanoparticles (surface plasmon resonance in metal nanoparticles)	Concentration, size, aggregation state (AuNPs: λmax ~520 nm; red shift indicates aggregation)
Fourier Transform Infrared (FTIR) spectroscopy	Absorption of IR radiation (molecular vibrations)	Surface functional groups; biomolecule binding
Raman spectroscopy	Inelastic scattering of monochromatic light (typically laser)	Molecular fingerprint; enhanced by SERS (surface-enhanced Raman) using metal nanoparticles
X-ray diffraction (XRD)	Diffraction of X-rays by crystal lattice	Crystalline structure; nanoparticle size (Scherrer equation)
X-ray photoelectron spectroscopy (XPS)	Photoelectron kinetic energy from X-ray irradiation	Elemental composition; oxidation states
Circular dichroism (CD)	Differential absorption of left- and right-circularly polarized light	Protein secondary structure; conformational changes of biomolecules on nanoparticles
Magnetic measurements (SQUID, VSM)	Magnetization vs. applied magnetic field	Superparamagnetic behavior; saturation magnetization (for iron oxide nanoparticles)

Part 3: Nanomaterials for Biological Applications

3.1 Classification of Nanomaterials

Class	Size	Composition	Examples	Key Properties
Nanoparticles	1-100 nm	Metal, metal oxide, polymer, lipid	Gold nanoparticles (AuNPs), iron oxide (SPIONs), silica, PLGA, liposomes	High surface area; surface functionalization; tunable optical/ magnetic properties
Nanowires/nanorods	1-100 nm diameter, up to μm length	Metal, semiconductor, carbon	Gold nanorods, silicon nanowires, ZnO nanowires	High aspect ratio; anisotropic properties (optical, electrical)
Nanotubes	1-2 nm diameter (SWCNT), 5-20 nm (MWCNT)	Carbon (graphene sheets rolled)	Single-walled (SWCNT), multi-walled (MWCNT)	High strength; electrical conductivity; high surface area
Graphene	0.34 nm thickness	Carbon (single atomic layer)	Graphene oxide (GO), reduced GO (rGO)	High surface area; electrical conductivity; mechanical strength
Quantum dots	2-10 nm	Semiconductor (CdSe, CdTe, InP, PbS)	CdSe/ZnS core-shell	Size-tunable fluorescence; narrow emission; high quantum yield; photostability
Dendrimers	2-10 nm	Branched polymers	PAMAM (polyamidoamine)	Monodisperse; controlled surface functionality; internal cavities
Liposomes	50-500 nm	Phospholipid bilayers	PEGylated liposomes (Doxil)	Biocompatible; encapsulation of hydrophobic & hydrophilic drugs
Viral nanoparticles	20-200 nm	Viral capsid proteins	Tobacco mosaic virus (TMV), cowpea mosaic virus (CPMV)	Monodisperse; genetic/chemical modification; biocompatible
Ferritin	12 nm	Protein cage (24 subunits)	Native ferritin (iron storage)	Uniform size; biocompatible; mineralization template

3.2 Gold Nanoparticles (AuNPs)

Key Properties:

Surface Plasmon Resonance (SPR): Collective oscillation of conduction electrons; absorption peak ~520 nm for 10-20 nm particles
Size-dependent color: 5-20 nm = red; 50-100 nm = blue/purple; larger = green/brown
Functionalization: Thiol (-SH) groups form strong Au-S bonds (covalent-like)
Biocompatibility: Low toxicity; inert core

Synthesis (Turkevich method):
HAuCl₄ + trisodium citrate (reducing agent) + heat → AuNPs (citrate-capped, negatively charged)

Applications:

Biosensing: Colorimetric detection (aggregation changes color); LSPR (localized SPR) sensors
Bioimaging: Dark-field microscopy (strong scattering); CT contrast agents
Drug delivery: Thiolated drugs (e.g., PEG, antibodies) attached to surface
Photothermal therapy: AuNPs convert near-infrared (NIR) light to heat → cancer cell destruction
SERS substrates: Enhanced Raman signal for detection

3.3 Quantum Dots (QDs)

Key Properties:

Quantum confinement: Bandgap increases as size decreases
Size-tunable emission: Smaller QDs = shorter λ (blue); larger QDs = longer λ (red)
Broad absorption; narrow emission (FWHM 20-40 nm)
High quantum yield (>50%)
Photostable (resistant to photobleaching)

Composition:

Core: CdSe, CdTe, InP, PbS (determines emission wavelength)
Shell: ZnS (passivates surface; improves quantum yield; reduces toxicity)
Coating: PEG, polymer, silica (improves water solubility; biocompatibility)

Toxicity concern: Cadmium (Cd) is toxic → heavy metal leaching; InP/ZnS less toxic alternatives available.

Applications:

Multiplexed imaging: Different colors from single excitation source
In vivo imaging: Near-infrared (NIR) QDs for deeper tissue penetration
FRET-based sensors: QD as donor; distance-sensitive
Lateral flow assays: Fluorescent QD labels (more sensitive than gold)

3.4 Iron Oxide Nanoparticles (SPIONs)

Key Properties:

Superparamagnetic: Magnetic only when external magnetic field applied (no remanence → no aggregation after field removed)
Composition: Magnetite (Fe₃O₄), maghemite (γ-Fe₂O₃)
Size: 5-20 nm typical for SPIONs

Synthesis:

Co-precipitation: FeCl₂ + FeCl₃ + base (NH₄OH) → Fe₃O₄ (pH 9-10, inert atmosphere)
Coating: Dextran, PEG, silica, or target ligands (antibodies, peptides)

Applications:

MRI contrast agents: T₂ contrast (darkening); SPIONs shorten T₂ relaxation time → enhanced contrast
Magnetic hyperthermia: SPIONs generate heat under alternating magnetic field (AMF) → cancer therapy
Magnetic separation: Capture target cells/molecules using magnetic field
Magnetic targeting: Localize drugs/particles to tumor site using external magnet
Theragnostics: Combined imaging + therapy

3.5 Carbon-based Nanomaterials

Material	Structure	Properties	Applications
Single-walled CNT (SWCNT)	Single graphene sheet rolled into cylinder (1-2 nm diameter)	Metallic or semiconducting; high tensile strength; NIR fluorescence	Biosensors; drug delivery; neural electrodes
Multi-walled CNT (MWCNT)	Multiple concentric graphene cylinders (5-20 nm diameter)	Conductive; high strength; lower cost	Electrodes; composite materials
Graphene oxide (GO)	Graphene sheet with oxygen groups (epoxide, hydroxyl, carboxyl)	Dispersible in water; chemically reactive; reduced to rGO	Drug delivery; biosensors; antibacterial
Reduced GO (rGO)	GO after chemical/thermal reduction (removes O groups)	Restores conductivity; less dispersible	Electrochemical sensors; energy storage

Biomedical Applications:

Drug delivery: Load drugs via π-π stacking (aromatic drugs) or covalent attachment
Biosensors: Electrochemical (enzyme electrodes); field-effect transistors (FET)
Antibacterial: Disrupts bacterial membranes (especially GO, CNTs)
Neural interfaces: CNT-based electrodes (high conductivity, biocompatibility)

Toxicity concerns: Pristine CNT/graphene may be toxic (size-dependent; needle-like; may cause mesothelioma-like effects). Functionalization reduces toxicity.

3.6 Liposomes

Structure: Self-assembled vesicles of phospholipid bilayers (unilamellar or multilamellar).

Type	Size	Lamellarity	Applications
Small unilamellar vesicles (SUV)	20-100 nm	Single bilayer	Drug delivery (small molecules)
Large unilamellar vesicles (LUV)	100-500 nm	Single bilayer	Drug delivery (larger payload)
Multilamellar vesicles (MLV)	500-5000 nm	Multiple concentric bilayers	Encapsulation; controlled release

Composition: Phosphatidylcholine (PC), cholesterol (stability), PEGylated lipids (stealth – evades opsonization/reticuloendothelial system)

Applications:

Drug delivery: Doxil (doxorubicin – FDA approved 1995); liposomal amphotericin B (AmBisome) – antifungal
Vaccines: mRNA-LNP (COVID-19 vaccines) – ionizable cationic lipids encapsulate mRNA
Gene delivery: Cationic liposomes (Lipofectamine) – transfect cells

Part 4: Biological Applications

4.1 Biosensors

Definition: Analytical devices that combine a biological recognition element (enzyme, antibody, DNA, cell) with a physicochemical transducer to detect target analytes.

Types of Biosensors by Transducer:

Transducer Type	Principle	Example	Detection Limit
Electrochemical	Measure current (amperometric), potential (potentiometric), or impedance	Glucose oxidase + Pt electrode (glucose meter)	μM range
Optical	Measure absorbance, fluorescence, SPR, SERS	AuNP-based LSPR; QD fluorescence	nM-pM range
Piezoelectric (QCM)	Mass change on crystal surface (frequency shift)	Antibody-coated quartz crystal (pathogen detection)	ng range
Field-effect transistor (FET)	Charge change at gate electrode	CNT-FET biosensor (DNA, protein)	fM range

Nanomaterials in Biosensors:

AuNPs: Localized surface plasmon resonance (LSPR); electrochemical signal amplification
CNTs/graphene: High surface area; electrical conductivity; FET sensors
QDs: Fluorescence; FRET-based sensors
Magnetic nanoparticles: Magnetic separation + detection (e.g., lateral flow assays)

Example – Glucose Biosensor:
Glucose + O₂ + H₂O —(glucose oxidase)→ Gluconic acid + H₂O₂
H₂O₂ —(Pt electrode, +0.6V)→ O₂ + 2H⁺ + 2e⁻ (current proportional to glucose concentration)

4.2 Drug Delivery Systems

Advantages of Nanocarriers:

Improved solubility (poorly soluble drugs)
Prolonged circulation time (PEGylation)
Targeted delivery (passive or active)
Controlled release (pH, temperature, enzyme-responsive)
Reduced side effects

Types of Drug Delivery Nanocarriers:

Carrier	Advantages	Limitations	Approved Examples
Liposomes	Biocompatible; encapsulates hydrophobic/hydrophilic drugs	Leakage; stability	Doxil (doxorubicin), AmBisome (amphotericin B)
Polymeric nanoparticles (PLGA, PLA)	Sustained release; high loading	Scale-up; polymer degradation	Lupron Depot (leuprolide – microspheres)
Dendrimers	Monodisperse; controlled drug attachment	Toxicity (cationic dendrimers)	Investigational (VivaGel – HIV microbicide)
Metal nanoparticles (Au, Fe₃O₄)	Multifunctional (imaging + therapy); photothermal	Long-term toxicity; accumulation	Investigational
Micelles	Small size; spontaneous assembly	Dilution instability	Genexol-PM (paclitaxel – Korea)
Albumin nanoparticles	Biocompatible; natural protein	Moderate loading	Abraxane (paclitaxel)

Passive Targeting (EPR Effect):

Enhanced Permeability and Retention effect
Leaky tumor vasculature (fenestrations 100-800 nm) → nanoparticles extravasate into tumor tissue
Poor lymphatic drainage → nanoparticles retained in tumor
Size requirement: 10-200 nm (too small: renal clearance; too large: unable to extravasate)

Active Targeting:

Surface functionalization with targeting ligands (antibody, aptamer, peptide, folic acid)
Binds to receptors overexpressed on cancer cells (e.g., HER2 (breast cancer), EGFR (solid tumors), folate receptor (ovarian cancer))
Example: HER2-targeted liposomal doxorubicin (MM-302 – investigational)

4.3 Imaging and Diagnostics

Modality	Nanocontrast Agent	Principle	Resolution	Depth
MRI	SPIONs (Fe₃O₄), Gd@C₈₂	T₂ shortening (dark) or T₁ shortening (bright)	10-100 μm	Whole body
CT	AuNPs, iodinated NPs, Bi₂S₃	X-ray attenuation (high atomic number)	50-200 μm	Whole body
Fluorescence	QDs, AuNPs (scattering), organic dyes	Emission at specific wavelength (excitation)	200-500 nm (super-resolution)	μm-mm (tissue scattering)
PET/SPECT	⁶⁴Cu-, ¹²⁴I-labeled NPs	Positron emission (PET); gamma emission (SPECT)	1-2 mm	Whole body
Photoacoustic	AuNPs, CNTs, QDs	Light absorption → thermal expansion → ultrasound detection	10-100 μm	cm
Raman (SERS)	Au or Ag NPs + Raman reporter	Enhanced Raman scattering (surface plasmon)	<1 μm (subcellular)	mm (surface)

4.4 Theranostics

Definition: Integration of therapy and diagnostics into single nanoplatform.

Examples:

SPIONs: MRI contrast + magnetic hyperthermia + drug delivery
AuNPs: CT contrast + photothermal therapy + drug delivery
QDs: Fluorescence imaging + drug delivery (QD-drug conjugates)
Liposomes: Imaging agent (MRI, fluorescence) + encapsulated drug

4.5 Antibacterial Nanomaterials

Nanomaterial	Mechanism	Advantages	Applications
Silver nanoparticles (AgNPs)	Ag⁺ release → ROS generation; membrane disruption; DNA binding	Broad-spectrum (bacteria, fungi, viruses)	Wound dressings, coatings, medical devices
Gold nanoparticles (AuNPs)	Photothermal (NIR laser); Au⁺ release (weak)	Biocompatible; can be targeted	Photothermal ablation of biofilms
Graphene oxide (GO)	Physical membrane disruption; oxidative stress	Broad-spectrum; synergistic with antibiotics	Wound dressings; coatings
Carbon nanotubes (CNTs)	Physical damage (needle-like) + oxidative stress	Broad-spectrum	Antimicrobial surfaces
Chitosan nanoparticles	Cationic surface disrupts bacterial membranes; biofilm penetration	Biodegradable; biocompatible	Drug delivery; wound healing
ZnO nanoparticles	ROS generation; Zn²⁺ release	Broad-spectrum; photocatalytic	Coatings; food packaging

Nanoparticle-resistant bacteria: Bacteria can develop resistance (reduced uptake; efflux pumps; biofilm formation). Combination therapy (NPs + antibiotics) overcomes resistance.

4.6 Tissue Engineering

Scaffold materials (nanofibers, hydrogels, nanocomposites):

Electrospun nanofibers (diameter 50-500 nm) mimic extracellular matrix (ECM)
Nanocomposite hydrogels: Incorporate nanoparticles (CNTs, HA, graphene) for improved mechanical/electrical properties

Applications:

Bone tissue engineering (hydroxyapatite nanoparticles)
Neural tissue engineering (CNT scaffolds – conductive)
Cardiac tissue engineering (CNT/graphene – electrical coupling)
Wound healing (AgNP-containing hydrogels; nanofiber dressings)

Part 5: Green Synthesis of Nanoparticles

5.1 Biological Synthesis Methods

Method	Source	Reducing Agent	Stabilizing Agent	Advantages	Disadvantages
Plant extract	Leaves, roots, fruits (neem, tulsi, aloe vera, tea)	Phytochemicals (flavonoids, terpenoids, phenolics, alkaloids)	Phytochemicals, proteins	Fast; scalable; low cost	Variability (seasonal, geographic)
Bacterial	Bacillus, Pseudomonas, E. coli, Streptomyces	NADPH-dependent reductases; electron shuttles (quinones)	Surface proteins, EPS	Well-defined shapes; high monodispersity	Slow growth; requires aseptic conditions
Fungal	Aspergillus, Fusarium, Penicillium, Trichoderma	Extracellular reductases; phytochelatins	Proteins, polysaccharides	High metal tolerance; easy recovery (filtration)	Slow growth; may produce mycotoxins
Algal	Chlorella, Spirulina, Sargassum, Fucus	Photosynthetic reductases; polysaccharides	Polysaccharides, proteins	Fast growth; low cost (CO₂ as carbon source)	Less characterized
Yeast	Saccharomyces cerevisiae, Candida	Intracellular reductases	Cell wall components (glucans, mannoproteins)	Easy cultivation	Intracellular (requires cell disruption)

Advantages of Green Synthesis:

No toxic chemicals (reducing/stabilizing agents)
Biocompatible surface coating (proteins, polysaccharides)
Low energy requirement (room temperature)
Scalable (plant extracts)
Single-step process

Disadvantages:

Poor control over size/morphology
Batch-to-batch variability (plant extracts)
Slow (bacterial/fungal methods)

Part 6: Toxicity and Safety of Nanomaterials

6.1 Routes of Exposure

Route	Source	Organs Affected
Inhalation	Industrial emissions, consumer sprays, workplace aerosols	Lungs, cardiovascular, central nervous system
Ingestion	Food additives, contaminated water, hand-to-mouth transfer	Gastrointestinal tract, liver, spleen
Dermal	Cosmetics (sunscreen TiO₂, ZnO), topical formulations	Skin (minimal penetration through intact skin)
Injection	Drug delivery (intravenous, intramuscular)	Distributed via bloodstream; uptake by RES (liver, spleen, kidney)

6.2 Mechanisms of Nanotoxicity

Mechanism	Description	Biomarkers
Reactive oxygen species (ROS) generation	Nanoparticles catalyze ROS production (O₂⁻, H₂O₂, OH•)	Glutathione depletion; lipid peroxidation (MDA); protein carbonylation
Mitochondrial damage	ROS leads to mitochondrial permeability transition (MPT)	ATP depletion; cytochrome c release (apoptosis)
DNA damage	Direct (intercalation) or indirect (ROS → oxidative DNA damage)	Comet assay; γ-H2AX foci; 8-oxo-dG
Inflammation	Nanoparticle uptake by macrophages → cytokine release (IL-1β, IL-6, TNF-α)	NF-κB activation; cytokine secretion; NLRP3 inflammasome
Protein corona formation	Adsorption of proteins on NP surface (alters biological identity)	Denaturation; loss of function; immune recognition
Membrane disruption	Physical interaction (especially sharp edges: CNTs, graphene)	LDH release; uptake of propidium iodide

6.3 Factors Affecting Toxicity

Factor	Effect on Toxicity	Explanation
Size	Smaller particles → higher toxicity	Larger surface area → more ROS; greater cellular uptake
Shape	Rods > spheres; sharp edges > rounded	Fiber-like (CNTs) cause frustrated phagocytosis (inflammation)
Surface charge	Cationic > anionic > neutral	Cationic interact with negatively charged cell membranes
Surface coating	PEGylation reduces toxicity; serum protein corona	Reduces opsonization; alters cellular uptake
Composition	Soluble metal ions (Ag⁺, Zn²⁺, Cd²⁺) toxic	Dissolution → ion toxicity
Aggregation state	Aggregated → reduced toxicity	Smaller effective surface area; altered cellular uptake
Surface functionalization	Targeting ligands may increase or decrease	Alters cellular uptake pathway

6.4 Regulatory Framework

Regulatory Agencies:

Agency	Region	Role
FDA	US	Approves nanomedicines (drugs, devices, cosmetics)
EPA	US	Regulates nano-pesticides; environmental release
ECHA	EU	REACH regulation (Registration, Evaluation, Authorization, Restriction of Chemicals)
ISO	International	Standards for nanomaterial characterization (ISO/TC 229)
OECD	International	Guidelines for testing nanomaterials

Key Concerns:

Lack of standardized toxicity testing protocols (OECD guidelines under development)
Characterization requirements (size, surface area, agglomeration, purity)
Need for life-cycle assessment (manufacturing → use → disposal)

Part 7: Applications Summary Table

Application	Nanomaterial Type	Key Features	Commercial Examples
Drug delivery	Liposomes, polymeric NPs, dendrimers	Encapsulation; controlled release; targeting	Doxil (liposomal doxorubicin), Abraxane (albumin-paclitaxel), mRNA-LNP (COVID vaccines)
Imaging (MRI)	SPIONs (iron oxide), Gd nanoparticles	T₂ or T₁ contrast	Feridex (SPION – withdrawn), Resovist (SPION – liver imaging)
Imaging (fluorescence)	QDs, AuNPs (scattering)	Multiplexing; photostability	Invitrogen Qdot probes (research; clinical limited due to Cd toxicity)
Photothermal therapy	AuNPs (nanorods, nanoshells), CNTs, graphene	NIR absorption → heat tumor	AuroLase (Au nanoshells – head/neck cancer; clinical trials)
Biosensors	AuNPs, CNTs, graphene, QDs	Sensitivity; specificity; rapid detection	Glucose test strips (AuNP-based), lateral flow assays (COVID-19 rapid tests)
Antibacterial	AgNPs, ZnO NPs, GO, chitosan	Broad-spectrum; wound dressings	Acticoat (AgNP wound dressing), Nanosilver socks, coatings
Magnetic separation	SPIONs (iron oxide)	Rapid isolation of cells/molecules	Dynabeads (magnetic beads for cell separation)
Theragnostics	SPIONs + drug, AuNPs + drug	Imaging + therapy	Ferumoxtran-10 (MRI + drug delivery – investigational)
Cosmetics	TiO₂, ZnO NPs (sunscreen)	UV protection; transparent	Many sunscreen brands (e.g., Neutrogena, La Roche-Posay)
Food	SiO₂ (anti-caking), AgNPs (preservative)	Improved texture; antimicrobial	Some food additives (regulatory approval varies)

Part 8: Exam Preparation Summary

8.1 Key Terminology

Term	Definition
Nanotechnology	Manipulation of matter at 1-100 nm scale
Nanobiotechnology	Application of nanotechnology to biological systems
Top-down vs. bottom-up	Approaches to fabricating nanostructures (removing material vs. building from atoms)
Self-assembly	Spontaneous organization of molecules into ordered structures
Surface plasmon resonance (SPR)	Collective oscillation of conduction electrons in metal nanoparticles
Quantum confinement	Size-dependent bandgap in semiconductor nanoparticles
Superparamagnetism	Magnetic only in external field (no remanence)
EPR effect	Enhanced Permeation and Retention (passive tumor targeting)
Theranostics	Integration of therapy and diagnostics
Protein corona	Adsorbed proteins on nanoparticle surface (biological identity)
SPIONs	Superparamagnetic iron oxide nanoparticles (Fe₃O₄, γ-Fe₂O₃)
QD (quantum dot)	Semiconductor nanocrystal with size-tunable fluorescence
LSPR	Localized surface plasmon resonance (AuNPs)
PEGylation	Coating with polyethylene glycol (stealth – reduces opsonization)
Zeta potential	Electrokinetic potential (measure of surface charge)
Hydrodynamic diameter	Apparent size of nanoparticle in solution (including hydration layer)
Polydispersity index (PDI)	Measure of size distribution width (0-1; lower = more monodisperse)

8.2 Sample Exam Questions

Short Answer (4-6 marks):

Explain the difference between top-down and bottom-up approaches in nanotechnology. Provide an example of each.
- (Answer: Top-down: etching larger material (photolithography); bottom-up: building from atoms/molecules (self-assembly, DNA origami).)
What is the EPR effect and why is it important for cancer nanomedicine?
- (Answer: Enhanced Permeability and Retention: leaky tumor vasculature + poor lymphatic drainage → nanoparticles accumulate in tumors; enables passive targeting.)
Calculate the zeta potential threshold for good colloidal stability. (Answer: >±30 mV for moderate; >±40 mV for excellent.)
Why are gold nanoparticles red in color? (Answer: Surface plasmon resonance at ~520 nm for 10-20 nm spheres; absorbs blue-green light → transmits red.)
What is the difference between passive and active targeting in drug delivery? (Answer: Passive: EPR effect (physical accumulation); Active: surface ligands bind to receptors overexpressed on target cells.)
List three characterization techniques for nanoparticles and the information each provides. (Answer: DLS – size; TEM – size/shape (high resolution); Zeta potential – surface charge.)
Explain why smaller nanoparticles (5 nm) may be more toxic than larger (50 nm) ones. (Answer: Larger surface area → more ROS; greater cellular uptake; may cross nuclear membrane.)
What is the protein corona and how does it affect nanoparticle behavior? (Answer: Adsorbed proteins on NP surface; alters biological identity, cellular uptake, immune recognition, and targeting efficiency.)
Define superparamagnetism. Why is it advantageous for biomedical applications? (Answer: Magnetic only when external field applied; no remanence → no aggregation after field removed; ideal for MRI, magnetic hyperthermia.)
What is the difference between TEM and SEM? (Answer: TEM: transmitted electrons (internal structure); requires thin samples; higher resolution (0.1 nm). SEM: secondary electrons (surface topography); bulk samples; lower resolution (1-10 nm).)

Long Answer/Essay (10-15 marks):

Describe the synthesis, properties, and biomedical applications of gold nanoparticles.
- (Answer: Synthesis: Turkevich method (citrate reduction). Properties: SPR (color); functionalization via thiols; biocompatibility. Applications: biosensing (colorimetric, LSPR), bioimaging (dark-field, CT), drug delivery (thiolated drugs), photothermal therapy (NIR), SERS.)
Explain the principle and applications of quantum dots in biological imaging. Discuss their advantages over organic dyes and their toxicity concerns.
- (Answer: QDs: semiconductor nanocrystals; size-tunable fluorescence (quantum confinement). Advantages: broad absorption, narrow emission, photostable, multiplexing (single excitation). Disadvantages: Cd toxicity; surface coating (ZnS, PEG) reduces toxicity. Applications: in vivo imaging (NIR), FRET sensors, multiplexed detection.)
Compare and contrast liposomes, polymeric nanoparticles, and dendrimers as drug delivery systems. Include size range, drug loading capacity, targeting strategies, and approved examples.
- (Answer: Liposomes: 50-500 nm; encapsulate hydrophilic/hydrophobic drugs; passive/active targeting; Doxil, AmBisome. Polymeric NPs: 50-300 nm; sustained release; PLGA, PLA; Lupron Depot. Dendrimers: 2-10 nm; monodisperse; controlled surface functionalization; VivaGel (investigational).)
**Describe the use of SPIONs (superparamagnetic iron oxide nanoparticles) in biomedical applications. Include synthesis, surface functionalization

BTH-4242: Environmental Biotechnology – Complete Study Notes

Environmental Biotechnology is the application of biological systems—particularly microorganisms and plants—to solve environmental problems and restore ecological balance. This field harnesses the natural capabilities of living organisms to degrade pollutants, treat waste, recover resources, and monitor environmental quality . These notes follow the standard structure of a comprehensive course, covering everything from fundamental microbial processes to advanced applications like bioelectrochemical systems and metagenomics .

PART ONE: INTRODUCTION AND FOUNDATIONS

1.1 What is Environmental Biotechnology?

Environmental biotechnology is the integration of natural sciences and engineering principles to achieve the sustainable application of biological systems for environmental protection and restoration . It bridges classical microbiology, biochemistry, and engineering to develop practical solutions for pollution control, waste management, and resource recovery.

Core Objectives:

Objective	Description
Pollution Prevention	Reduce or eliminate pollution at its source through cleaner production
Pollution Control	Treat pollutants after they have been generated
Environmental Restoration	Remediate contaminated sites to restore ecosystem health
Resource Recovery	Convert waste streams into valuable products (energy, chemicals, fertilizers)
Monitoring and Assessment	Use biological indicators to detect and measure environmental contamination

1.2 Historical Development and Scope

The field has evolved significantly over the past century:

Era	Key Developments
Early 20th Century	Activated sludge process for wastewater treatment
Mid 20th Century	Anaerobic digestion for sludge stabilization
1970s-1980s	Growing awareness of xenobiotics; bioremediation research
1990s	Application of genetic engineering; phytoremediation advances
2000s-Present	Metagenomics, microbial fuel cells, bioelectrochemical systems, circular bioeconomy

1.3 Global Environmental Challenges Addressed

Water Pollution: Industrial effluents, agricultural runoff, domestic sewage
Soil Contamination: Heavy metals, petroleum hydrocarbons, pesticides, industrial solvents
Air Pollution: Volatile organic compounds, greenhouse gases, odors
Solid Waste: Municipal waste, industrial byproducts, plastic pollution
Climate Change: CO₂ sequestration, renewable energy from waste

PART TWO: MICROBIAL PROCESSES IN ENVIRONMENTAL SYSTEMS

2.1 Microbial Metabolism: The Engine of Environmental Biotechnology

All environmental biotechnologies ultimately depend on microbial metabolism. Understanding the diversity of microbial energy and carbon sources is essential.

Nutritional Classification of Microorganisms:

Type	Carbon Source	Energy Source	Electron Donor	Environmental Role
Photoautotrophs	CO₂	Light	H₂O (oxygenic) or H₂S (anoxygenic)	Primary producers; algae in wastewater ponds
Photoheterotrophs	Organic	Light	Organic	Minor role; some purple non-sulfur bacteria
Chemolithoautotrophs	CO₂	Inorganic chemicals (H₂, NH₃, H₂S, Fe²⁺)	Inorganic	Nitrification, sulfur oxidation, iron oxidation
Chemolithoheterotrophs	Organic	Inorganic chemicals	Inorganic	Some sulfur-oxidizing bacteria
Chemoorganoheterotrophs	Organic	Organic	Organic	Most bioremediation and wastewater treatment organisms

Key Catabolic Pathways in Environmental Contexts:

Pathway	Input	Output	Electron Acceptor	Environmental Application
Aerobic Respiration	Organic matter	CO₂, H₂O	O₂	Activated sludge, composting
Anaerobic Respiration	Organic matter	CO₂, reduced products	NO₃⁻, SO₄²⁻, Fe³⁺, etc.	Denitrification, sulfate reduction
Fermentation	Organic matter	Organic acids, alcohols	Organic intermediate	Anaerobic digesters (first stage)
Methanogenesis	H₂ + CO₂ or acetate	CH₄	CO₂ (reduced to CH₄)	Biogas production
Anammox	NH₄⁺ + NO₂⁻	N₂	NO₂⁻	Nitrogen removal from wastewater
Nitrification	NH₄⁺	NO₃⁻	O₂	Nitrogen removal (two-step process)

2.2 Aerobic vs. Anaerobic Processes

Feature	Aerobic Processes	Anaerobic Processes
Electron Acceptor	Molecular oxygen (O₂)	Nitrate, sulfate, ferric iron, carbon dioxide, organic compounds
Energy Yield	High (~38 ATP/glucose)	Low (~2-36 ATP/glucose, depending on acceptor)
Growth Rate	Fast	Slow
Biomass Production	High	Low
Residual Organics	Low	Moderate to high
End Products	CO₂, H₂O, biomass	CH₄, H₂S, NH₃, organic acids, CO₂
Oxygen Requirement	Yes	No
Typical Applications	Activated sludge, biofilters, composting	Anaerobic digestion, denitrification, methanogenesis

2.3 Microbial Growth Kinetics and Reactor Design

The design and operation of biological treatment systems rely on understanding microbial growth kinetics.

Monod Equation (Growth Rate):

$μ = K ^{s} + S μ ^{ma x} S$

Where:

$μ$ = specific growth rate (time⁻¹)
$μ_{ma x}$ = maximum specific growth rate
$S$ = limiting substrate concentration (mg/L)
$K_{s}$ = half-saturation constant (substrate concentration at 0.5 $μ_{ma x}$ )

Substrate Utilization Rate:

$r_{s} = - Y μ X = - K ^{s} + S k SX$

Where:

$r_{s}$ = substrate utilization rate
$X$ = biomass concentration
$Y$ = yield coefficient (biomass produced per substrate consumed)
$k = μ_{ma x} / Y$ = maximum specific substrate utilization rate

Key Parameters in Wastewater Treatment:

Parameter	Definition	Typical Range (Domestic Wastewater)
Y (Yield)	Biomass produced per substrate consumed	0.4-0.8 g VSS/g COD
k_d (Decay rate)	Biomass loss due to endogenous respiration	0.05-0.15 day⁻¹
μ_max	Maximum growth rate	2-10 day⁻¹
K_s	Half-saturation constant	20-100 mg/L BOD

Chemostat Theory (Continuous Culture):
In a continuous stirred-tank reactor (CSTR) without recycle:

$D = V Q = μ (at steady state)$

The dilution rate ( $D$ ) determines which organisms can be maintained. Washout occurs when $D > μ_{ma x}$ .

PART THREE: WASTEWATER TREATMENT

Wastewater treatment is one of the most mature and widespread applications of environmental biotechnology.

3.1 Overview of Wastewater Treatment Levels

Treatment Level	Purpose	Processes
Preliminary	Remove large solids, grit, and grease	Screening, grit chambers, equalization
Primary	Remove settleable solids	Sedimentation (primary clarifiers)
Secondary (Biological)	Remove dissolved and colloidal organic matter	Activated sludge, trickling filters, lagoons
Tertiary (Advanced)	Remove specific pollutants (nutrients, pathogens, trace organics)	Filtration, disinfection, nutrient removal, adsorption
Sludge Treatment	Stabilize and dewater biosolids	Thickening, digestion, dewatering

3.2 Major Biological Wastewater Treatment Systems

Stabilization Ponds (Lagoon Systems):

Pond Type	Depth	Oxygen Conditions	Function
Anaerobic Pond	2-5 m	Anaerobic	High-strength waste; BOD reduction 40-70%
Facultative Pond	1-2 m	Anaerobic (bottom), aerobic (surface)	Primary BOD removal; algae produce oxygen
Maturation (Polishing) Pond	0.5-1.5 m	Aerobic	Pathogen removal; nutrient uptake by algae
Aerated Lagoon	2-5 m	Aerobic (mechanical aeration)	Higher rate than facultative ponds

Activated Sludge Process:

Influent → Primary Clarifier → Aeration Basin → Secondary Clarifier → Effluent
                                    ↑                    ↓
                                  Return               Waste
                              Activated Sludge     Activated Sludge

Key Configurations:

Configuration	Description	Advantages	Disadvantages
Conventional	Plug flow reactor with long narrow basin	Good treatment; stable operation	Large footprint
Complete Mix	Uniform conditions throughout basin	Resists shock loads; simple control	Potential for sludge bulking
Extended Aeration	Long HRT (18-36 hours) and SRT (20-40 days)	Low sludge production; stable operation	High energy cost
Sequencing Batch Reactor (SBR)	Fill-react-settle-decant in single tank	Flexible; small footprint	Complex timing controls
Oxidation Ditch	Circular/oval channel with brush aerators	Low maintenance; energy efficient	Limited capacity for large flows

Aerobic Biofilm Reactors:

Type	Media	Mechanism	Application
Trickling Filter	Rock, plastic modules	Wastewater trickles over media; biofilm degrades organics	Low to moderate loads
Rotating Biological Contactor (RBC)	Closely spaced plastic discs	Discs rotate through wastewater and air	Small to medium flows
Submerged Aerated Biofilter (SABF)	Submerged media with aeration	Biomass attached to submerged media	High-rate treatment
Moving Bed Biofilm Reactor (MBBR)	Free-floating plastic carriers	Carriers move in aerated tank	Compact; flexible; upgrading existing plants

Anaerobic Treatment Systems:

System	HRT	Loading Rate	Application
Septic Tank	24-72 hours	Low	On-site; primary treatment
Upflow Anaerobic Sludge Blanket (UASB)	4-12 hours	5-20 kg COD/m³·day	High-strength industrial wastewater
Anaerobic Filter	6-24 hours	3-15 kg COD/m³·day	Soluble wastewaters
Anaerobic Digester	15-30 days	1-4 kg VS/m³·day	Sludge stabilization, biogas production

3.3 Nutrient Removal

Eutrophication of receiving waters requires removal of nitrogen and phosphorus.

Nitrogen Removal (Nitrification + Denitrification):

Process	Reaction	Microorganisms	Conditions
Nitrification (Step 1)	NH₄⁺ → NO₂⁻	Nitrosomonas, Nitrosospira	Aerobic (DO > 2 mg/L)
Nitrification (Step 2)	NO₂⁻ → NO₃⁻	Nitrobacter, Nitrospira	Aerobic (DO > 2 mg/L)
Denitrification	NO₃⁻ → N₂ (gas)	Paracoccus, Pseudomonas, many others	Anoxic (no O₂, nitrate present)

Anammox (Anaerobic Ammonium Oxidation):
NH₄⁺ + NO₂⁻ → N₂ + 2H₂O

60% less oxygen demand than conventional nitrification-denitrification
No organic carbon required for denitrification
Used in side-stream treatment (digester supernatant)

Phosphorus Removal:

Method	Mechanism	Biological Agent	P Removal Efficiency
Enhanced Biological Phosphorus Removal (EBPR)	Phosphate-accumulating organisms (PAOs) take up excess P under alternating anaerobic/aerobic conditions	Acinetobacter, Candidatus Accumulibacter	70-90%
Chemical Precipitation	Metal salts (alum, ferric chloride) precipitate phosphate	Chemical reaction	80-95%
Phosphorus Recovery	Struvite precipitation (MgNH₄PO₄·6H₂O)	From digester supernatant	80-90% as fertilizer

PART FOUR: SLUDGE TREATMENT AND MANAGEMENT

Sludge (biosolids) is an inevitable byproduct of wastewater treatment. Its management represents 30-60% of total treatment plant operating costs.

4.1 Sludge Properties

Parameter	Range (Primary Sludge)	Range (Waste Activated Sludge)
Total Solids (TS)	3-8%	0.5-1.5%
Volatile Solids (VS)	60-80% of TS	70-85% of TS
Specific Gravity	1.02-1.03	1.00-1.01
pH	5.0-6.5	6.5-7.5
Protein (% of TS)	20-30%	30-40%
Lipids (% of TS)	6-30%	5-10%

4.2 Sludge Treatment Stages

Stage	Purpose	Methods
Thickening	Reduce volume by removing water	Gravity thickening, dissolved air flotation, centrifuge
Stabilization	Reduce pathogens, odor, and putrescibility	Anaerobic digestion, aerobic digestion, lime stabilization, composting
Conditioning	Improve dewaterability	Polymer addition, heat treatment, elutriation
Dewatering	Further volume reduction	Centrifuge, belt filter press, drying beds, filter press
Disinfection	Eliminate pathogens	Pasteurization, thermophilic digestion, irradiation
Final Disposal/Use	Beneficial use or disposal	Land application (fertilizer), landfill, incineration

4.3 Anaerobic Digestion

Process Stages:

Stage	Substrate	Product	Microorganisms
Hydrolysis	Complex organics (polymers)	Soluble monomers (sugars, amino acids, fatty acids)	Hydrolytic bacteria (Clostridium, Bacteroides, etc.)
Acidogenesis	Monomers	Volatile fatty acids (VFAs), alcohols, H₂, CO₂	Acidogenic bacteria
Acetogenesis	VFAs (propionate, butyrate), alcohols	Acetate, H₂, CO₂	Acetogenic bacteria (Syntrophomonas, etc.)
Methanogenesis	Acetate, H₂ + CO₂	CH₄, CO₂	Methanogens (Methanosarcina, Methanosaeta, Methanobacterium)

Biogas Composition:

Methane (CH₄): 50-70%
Carbon dioxide (CO₂): 30-50%
Hydrogen sulfide (H₂S): 0-2%
Ammonia (NH₃): trace

Key Operating Parameters:

Parameter	Optimum Range
Temperature (Mesophilic)	30-38°C
Temperature (Thermophilic)	50-57°C
pH	6.8-7.5
Alkalinity (as CaCO₃)	2,000-5,000 mg/L
Volatile Fatty Acids	< 500 mg/L (as acetic acid)
C:N Ratio	20-30:1
Hydraulic Retention Time	15-30 days (mesophilic); 10-15 days (thermophilic)
Organic Loading Rate	1-4 kg VS/m³·day

4.4 Composting

Aerobic biological decomposition of organic waste under controlled conditions.

Parameter	Optimum Range
C:N Ratio	25-35:1
Moisture Content	50-60%
Oxygen Concentration	> 5-10%
Temperature	55-65°C (thermophilic phase)
pH	6.5-8.0
Particle Size	1.3-5 cm

Composting Systems:

Windrow composting
Aerated static pile
In-vessel composting

PART FIVE: BIOREMEDIATION

Bioremediation uses microorganisms (and plants) to degrade, transform, or immobilize environmental contaminants.

5.1 Principles of Bioremediation

Favorable Conditions for Bioremediation:

Appropriate electron acceptor (O₂, NO₃⁻, SO₄²⁻, etc.)
Adequate nutrients (N, P, trace metals)
Suitable pH (6-8 for most bacteria)
Appropriate temperature (20-35°C for mesophiles)
Contaminant bioavailability

Factors Limiting Bioremediation:

Low contaminant solubility/bioavailability
Toxicity of contaminants to microorganisms
Lack of appropriate microbial populations
Unfavorable environmental conditions
Presence of inhibiting co-contaminants

5.2 Bioremediation Strategies

Strategy	Description	Application
Natural Attenuation	Relies on natural microbial processes without human intervention	Low contamination levels; favorable conditions
Biostimulation	Adding nutrients, electron acceptors, or other amendments to stimulate native microbial activity	Widespread contamination; appropriate microbes present
Bioaugmentation	Introducing specific microbial cultures to enhance degradation	Refractory contaminants; slow native degradation
Bioventing	Supplying air (O₂) to unsaturated zone to stimulate aerobic degradation	Petroleum hydrocarbons in vadose zone
Biosparging	Injecting air into saturated zone	Petroleum hydrocarbons in groundwater
Bioslurping	Combined vacuum extraction of free product and bioventing	Light non-aqueous phase liquids (LNAPLs)

5.3 In Situ vs. Ex Situ Techniques

Feature	In Situ	Ex Situ
Location	Treatment occurs in place	Contaminated material is excavated/removed
Disturbance	Minimal	Significant (excavation, transport)
Control	Limited	Greater (controlled conditions)
Cost	Generally lower	Higher (excavation, handling)
Time	Longer	Shorter
Typical Applications	Deep contamination, large areas	Shallow contamination, hot spots

Ex Situ Technologies:

Technology	Description	Applications
Land Farming	Contaminated soil spread in thin layer; periodic tilling	Petroleum hydrocarbons
Composting	Mix with bulking agent; controlled aerobic degradation	Explosives, PAHs, pesticides
Biopiles	Heaped soil with aeration system	Petroleum hydrocarbons
Bioreactors	Slurry-phase treatment in engineered vessel	High concentrations; rapid treatment

5.4 Biofiltration for Air Treatment

Biofilters treat contaminated air (VOCs, odors) by passing it through a moist packed bed containing active microorganisms.

Parameter	Optimum Range
pH	6-8 (adjustable)
Moisture Content	40-60%
Temperature	20-40°C
Empty Bed Residence Time (EBRT)	30-120 seconds
Loading Rate	10-100 g/m³·h

Advantages:

Low operating cost
Ambient temperature/pressure
Complete destruction (not just transfer)
No secondary waste

Limitations:

Large footprint
Sensitive to shock loads
Requires humidification
Not suitable for high concentrations

5.5 Bioleaching (Biomining)

The use of microorganisms to solubilize metals from ores or waste materials.

Microorganism	Conditions	Metals Leached
Acidithiobacillus ferrooxidans	Aerobic, acidophilic (pH 1.5-2.5)	Fe, Cu, U, Au (indirect), Ni, Co, Zn
Acidithiobacillus thiooxidans	Aerobic, acidophilic	Sulfur oxidation; assists iron oxidizers
Leptospirillum ferrooxidans	Aerobic, acidophilic	Fe (ferrous iron)
Sulfolobus spp.	Thermophilic (60-80°C), acidophilic	Cu, Mo, Co

Mechanisms:

Direct: Microorganisms directly oxidize metal sulfides (e.g., FeS₂ + O₂ → Fe²⁺ + SO₄²⁻)
Indirect: Ferric iron (Fe³⁺) produced by microbes oxidizes metal sulfides; ferric is reduced to ferrous and re-oxidized by microbes

PART SIX: PHYTOREMEDIATION

Phytoremediation uses plants to remove, degrade, or stabilize environmental contaminants.

6.1 Phytoremediation Mechanisms

Mechanism	Process	Contaminants	Typical Plants
Phytoextraction	Plant uptake and accumulation in harvestable tissues (shoots)	Heavy metals (Cd, Ni, Zn, As, Se)	Hyperaccumulators (Thlaspi, Alyssum, Pteris vittata)
Phytostabilization	Immobilization in root zone (precipitation, sorption)	Heavy metals, radionuclides	Grasses, willows, poplars
Phytovolatilization	Uptake and release as volatile form	Selenium, mercury, some organics	Brassica, poplars
Phytodegradation	Breakdown within plant tissues	Organic contaminants	Poplars, grasses, aquatic plants
Rhizodegradation (Phytostimulation)	Enhanced microbial degradation in root zone	Petroleum hydrocarbons, PAHs, pesticides	Grasses, legumes, poplars
Rhizofiltration	Adsorption/precipitation onto roots (hydroponic)	Heavy metals, radionuclides	Aquatic plants (Eichhornia, Lemna)
Phytodesalination	Salt accumulation in halophytes	Salinity	Salt-tolerant plants (Atriplex, Salicornia)

6.2 Hyperaccumulators

Hyperaccumulator plants can concentrate metals to levels >1000 mg/kg dry weight.

Metal	Hyperaccumulator	Accumulation Level
Nickel	Alyssum bertolonii, Psychotria douarrei	> 1000 mg/kg
Zinc	Thlaspi caerulescens	> 10,000 mg/kg
Cadmium	Thlaspi caerulescens, Arabidopsis halleri	> 100 mg/kg
Arsenic	Pteris vittata (Chinese brake fern)	> 1000 mg/kg
Copper	Haumaniastrum robertii	> 1000 mg/kg
Selenium	Astragalus spp.	> 1000 mg/kg

6.3 Advantages and Limitations of Phytoremediation

Advantages	Limitations
Low cost	Slow process (multiple growing seasons)
Aesthetic; public acceptance	Limited to shallow contamination (root zone)
In situ	Contaminant toxicity to plants
Minimal environmental disturbance	Harvesting and disposal of contaminated biomass
Applicable to large areas	Climate and season dependent
Potential for metal recovery (phytomining)	Limited to bioavailable fraction

PART SEVEN: MICROBIAL ELECTROCHEMICAL SYSTEMS

Bioelectrochemical systems (BES) use microorganisms as catalysts to generate electricity or produce valuable chemicals from organic waste.

7.1 Microbial Fuel Cells (MFCs)

MFCs convert chemical energy in organic matter directly into electrical energy using electroactive bacteria.

Basic MFC Configuration:

Anode Chamber (Anaerobic)              Cathode Chamber (Aerobic)
         |                                      |
   Organic substrate + H₂O → CO₂ + H⁺ + e⁻     O₂ + 4H⁺ + 4e⁻ → 2H₂O
         |                                      |
         └────────── e⁻ (through external circuit) ──────┘
                    H⁺ (through membrane)

Electroactive Bacteria:

Organism	Electron Transfer Mechanism	Substrates
Shewanella oneidensis	Direct contact; soluble electron shuttles	Lactate, pyruvate
Geobacter sulfurreducens	Direct contact (pili/nanowires)	Acetate
Pseudomonas aeruginosa	Soluble electron shuttles (pyocyanin)	Diverse organics
Mixed consortia	Various	Wastewater organics

7.2 Other Bioelectrochemical Systems

System	Description	Products
Microbial Electrolysis Cell (MEC)	External voltage applied to drive non-spontaneous reactions	Hydrogen (H₂)
Microbial Electrosynthesis (MES)	Electrons supplied to microbes to reduce CO₂	Acetate, butyrate, other chemicals
Microbial Desalination Cell (MDC)	Three-chamber system for desalination using MFC principle	Fresh water
Sediment MFC	MFC in sediment to power remote sensors	Electricity

7.3 Applications and Challenges

Application	Status	Challenge
Wastewater treatment + power generation	Laboratory/pilot	Low power density; high material cost
Remote sensors	Prototype	Long-term stability
Biohydrogen production	Laboratory	Low production rates; energy input
Metal recovery	Laboratory	Selectivity; scale-up

PART EIGHT: BIOREFINERY AND CIRCULAR BIOECONOMY

8.1 The Biorefinery Concept

A biorefinery integrates biomass conversion processes to produce fuels, power, heat, and value-added chemicals, analogous to a petroleum refinery.

Feedstock Types:

First generation: Food crops (corn, sugarcane, vegetable oils)
Second generation: Lignocellulosic biomass (agricultural residues, wood, dedicated energy crops)
Third generation: Algae
Waste streams: Municipal solid waste, industrial byproducts, wastewater

Biorefinery Platforms:

Platform	Input	Output	Technology
Sugar Platform	Cellulose, hemicellulose	Sugars → ethanol, butanol, organic acids	Hydrolysis, fermentation
Syngas Platform	Lignocellulosic biomass	CO + H₂ → alcohols, alkanes	Gasification, fermentation
Biogas Platform	Organic waste (wet)	CH₄ → electricity, heat, methanol	Anaerobic digestion
Biodiesel Platform	Oils, fats, algae	Fatty acid methyl esters (FAME), glycerol	Transesterification
Green Chemistry Platform	Biomass-derived chemicals	Bioplastics, biosurfactants, fine chemicals	Fermentation, catalysis

8.2 Biofuels from Waste

Biofuel	Feedstock	Process	Yield
Biogas (CH₄)	Organic waste, sludge	Anaerobic digestion	0.3-0.8 m³/kg VS
Biohydrogen	Organic waste	Dark fermentation, photofermentation	1-3 mol H₂/mol glucose
Bioethanol	Lignocellulose, waste sugars	Hydrolysis + fermentation	300-400 L/ton dry biomass
Biodiesel	Waste cooking oil, algal oil	Transesterification	800-900 L/ton oil
Biobutanol	Waste biomass	Acetone-butanol-ethanol (ABE) fermentation	200-250 L/ton

8.3 Value-Added Products from Waste Streams

Product	Source Waste	Microorganism	Application
Polyhydroxyalkanoates (PHA)	Volatile fatty acids from waste	Cupriavidus necator, mixed cultures	Bioplastics
Biosurfactants	Waste oils, carbohydrates	Bacillus, Pseudomonas, Candida	Detergents, emulsifiers
Biofertilizers	Digestate, compost	Nitrogen-fixing bacteria, phosphate-solubilizers	Agriculture
Single Cell Protein (SCP)	Methane, hydrogen, waste organics	Methylococcus, Candida, algae	Animal feed
Biocontrol agents	Agricultural waste	Bacillus thuringiensis, Trichoderma	Biopesticides
Bioplastics	Lactic acid from waste	Lactobacillus	PLA production

PART NINE: ENVIRONMENTAL MONITORING AND BIOSENSORS

9.1 Bioindicators

Organisms or communities used to assess environmental quality.

Indicator Type	Organisms	What They Indicate
Macroinvertebrates	Aquatic insects, worms, mollusks	Water quality (stream health)
Fish	Salmonids, cyprinids	Long-term water quality; toxicity
Algae (periphyton, phytoplankton)	Diatoms, green algae	Nutrient pollution; organic enrichment
Lichens	Epiphytic lichens	Air pollution (SO₂, NOₓ, heavy metals)
Plants (vascular)	Aquatic and terrestrial plants	Heavy metals; salinity; eutrophication
Microbial indicators	Coliforms, fecal streptococci	Fecal contamination

Biomonitoring Indices:

Biotic Index (BI): Based on pollution tolerance values of macroinvertebrates
EPT Index: Number of Ephemeroptera, Plecoptera, Trichoptera taxa (high = clean water)
Diatom Assemblage Index: Ratio of sensitive to tolerant diatom species
Lichens Diversity Value (LDV): Index based on lichen species richness and coverage

9.2 Biosensors

Analytical devices that combine a biological recognition element with a physical transducer to detect specific analytes.

Type	Biological Element	Transducer	Target Analytes
Enzyme biosensors	Glucose oxidase	Electrochemical	Glucose, pesticides
Microbial biosensors	Whole-cell bacteria	Electrochemical, optical	BOD, toxicity, heavy metals
Antibody biosensors (immunosensors)	Antibodies	Optical (surface plasmon resonance), electrochemical	Pathogens, pesticides, hormones
DNA biosensors (genosensors)	DNA probes	Electrochemical, optical	Genetic sequences, mutations
Aptamer biosensors	DNA/RNA aptamers	Various	Diverse targets

Environmental Applications:

BOD (Biochemical Oxygen Demand) sensors: Rapid (15-30 min) vs. 5-day standard method
Toxicity sensors: Bioluminescent bacteria (Vibrio fischeri) respond to toxicants
Nutrient sensors: Nitrate, phosphate (enzyme or microbial based)
Pathogen detection: E. coli, Salmonella in water

9.3 Metagenomics for Environmental Monitoring

Metagenomics (direct sequencing of DNA from environmental samples) provides a culture-independent view of microbial communities.

Application	What It Reveals
Community composition	Who is there (16S/18S rRNA gene sequencing)
Functional potential	What they can do (metagenome sequencing)
Gene expression	What they are actively doing (metatranscriptomics)
Biocatalyst discovery	Novel enzymes for industrial applications
Pathogen detection	Presence of pathogenic bacteria, viruses, antibiotic resistance genes
Bioremediation potential	Presence of degradation pathways

PART TEN: EMERGING AND SPECIAL TOPICS

10.1 Biodegradation of Recalcitrant Compounds

Compound Class	Examples	Challenges	Biodegradation Approaches
Chlorinated solvents	TCE, PCE, carbon tetrachloride	High degree of chlorination	Reductive dechlorination (anaerobic)
Polychlorinated biphenyls (PCBs)	Aroclors	Low bioavailability; multiple chlorines	Sequential anaerobic-aerobic treatment
Polycyclic aromatic hydrocarbons (PAHs)	Benzo[a]pyrene, pyrene	Low solubility; high molecular weight	Fungal (lignin peroxidases) + bacterial
Pesticides	DDT, atrazine, lindane	Variable structure; some persistent	Specialized bacteria (Pseudomonas, Sphingomonas)
Explosives	TNT, RDX, HMX	Toxicity to microbes; nitro groups	Nitroreductases; composting
Pharmaceuticals	Antibiotics, hormones	Low concentrations; mixture effects	Advanced oxidation + biodegradation
Plastics	PET, polyethylene, polystyrene	Highly recalcitrant; low surface area	Hydrolytic enzymes (PETase); fungal degradation

10.2 Extremophiles in Environmental Biotechnology

Extremophile Type	Optimal Conditions	Environmental Application
Thermophiles	50-80°C	High-temperature waste treatment; composting; enzyme production
Psychrophiles	0-20°C	Cold-climate bioremediation; food waste treatment
Halophiles	2-5 M NaCl	Treatment of saline/hypersaline wastewaters
Acidophiles	pH 1-4	Bioleaching; acid mine drainage remediation
Alkaliphiles	pH 9-11	Treatment of alkaline industrial waste

10.3 Environmental Applications of Genetically Engineered Microorganisms (GEMs)

Modification	Purpose	Examples
Degradation pathway enhancement	Broader substrate range; faster degradation	Modified Pseudomonas for PCB degradation
Biosensor development	Specific detection of pollutants	Bioluminescent reporter strains for toxicity
Bioaccumulation	Enhanced metal uptake	Metallothionein-expressing bacteria
Biocontrol	Pest/pathogen suppression	Bt toxin genes in non-pathogenic bacteria

Concerns with GEMs:

Horizontal gene transfer to native populations
Unpredictable ecological effects
Regulatory barriers
Public acceptance

10.4 Microbial CO₂ Sequestration and Bioenergy

Pathway	Microorganisms	Products	Carbon Fate
Photosynthesis (algae, cyanobacteria)	Chlorella, Spirulina, Synechocystis	Biomass, lipids, carbohydrates	Fixed into biomass
Hydrogenotrophic methanogenesis	Methanobacterium, Methanococcus	CH₄ (biogas)	Converted to methane
Autotrophic acetogenesis	Acetobacterium, Clostridium	Acetate, ethanol	Reduced to organic acids
Microbial electrosynthesis	Sporomusa ovata, Clostridium ljungdahlii	Acetate, butyrate

BTH-4252: Health Biotechnology – Comprehensive Study Notes

Part 1: Introduction to Health Biotechnology

1.1 Definition and Scope

Health Biotechnology: The application of biological principles and techniques to develop products, diagnostics, therapeutics, and devices that improve human health. It encompasses the use of living systems and organisms to create or modify health-related products.

Key Areas of Health Biotechnology:

Area	Focus	Examples
Biopharmaceuticals	Protein-based drugs produced by recombinant DNA technology	Insulin, monoclonal antibodies, growth factors, vaccines
Gene therapy	Introduction of genetic material to treat or prevent disease	CAR-T cells, AAV-delivered genes, CRISPR-based therapies
Regenerative medicine	Repair or replace damaged tissues/organs	Stem cell therapy, tissue engineering, organoids
Diagnostics	Detection of disease biomarkers	PCR, ELISA, lateral flow assays, NGS, liquid biopsy
Pharmacogenomics	Genetic variation influencing drug response	Companion diagnostics, personalized medicine
Vaccines	Prevention of infectious diseases	Recombinant protein vaccines, mRNA vaccines, viral vectors
Nanomedicine	Nanoparticles for drug delivery, imaging	Liposomes, polymeric nanoparticles, gold nanoparticles

1.2 Historical Milestones in Health Biotechnology

Year	Development	Significance
1973	First recombinant DNA (Cohen & Boyer)	Foundation of genetic engineering
1978	Recombinant human insulin (Genentech)	First recombinant protein therapeutic
1982	FDA approves recombinant human insulin	First biotech drug
1986	First monoclonal antibody therapeutic (muromonab-CD3, OKT3)	Blockbuster drug class begins
1990	First human gene therapy trial (ADA-SCID)	Gene therapy enters clinic (NIH – Anderson, Blaese, Culver)
1997	First chimeric monoclonal antibody (rituximab)	Reduced immunogenicity
1998	First humanized monoclonal antibody (palivizumab)	Further reduced immunogenicity
2002	First fully human monoclonal antibody (adalimumab – Humira)	Highest-grossing drug (before biosimilars)
2003	Human Genome Project completed	Blueprint for personalized medicine
2010	First iPSC-derived therapy (clinical trial)	Regenerative medicine
2012	CAR-T cell therapy first success (Emily Whitehead)	Breakthrough in cancer immunotherapy
2017	FDA approves first gene therapy for inherited disease (Luxturna – RPE65 mutation; Spark Therapeutics)	Milestone for AAV gene therapy
2017	FDA approves first CAR-T cell therapy (tisagenlecleucel – Kymriah; Novartis)	Personalized cancer immunotherapy
2020	First mRNA vaccines (Pfizer/BioNTech, Moderna) authorized for COVID-19	Platform technology validation (emergency use authorization)
2023	First CRISPR-based therapy (exa-cel – CASGEVY) approved for sickle cell disease and transfusion-dependent β-thalassemia (UK, then US 2024)	Gene editing enters clinic

Part 2: Biopharmaceuticals

2.1 Definition and Classification

Definition: Biopharmaceuticals (biologics) are medicinal products manufactured using living organisms through biotechnological processes. They are typically large, complex molecules (proteins, nucleic acids) compared to small-molecule drugs.

Classification of Biopharmaceuticals:

Class	Examples	Molecular weight	Administration
Monoclonal antibodies (mAbs)	Rituximab, trastuzumab, adalimumab, pembrolizumab	~150 kDa	IV, SC
Recombinant therapeutic proteins	Insulin, growth hormone, EPO, tPA, factor VIII	5-150 kDa	IV, SC, IM
Fusion proteins	Etanercept (TNFR-Fc), aflibercept (VEGFR-Fc)	~150 kDa	SC, IV
Vaccines (recombinant)	HBV vaccine, HPV vaccine (Gardasil), COVID-19 vaccines (recombinant protein: Novavax)	Variable	IM
Nucleic acid therapeutics	mRNA vaccines, antisense oligonucleotides (ASOs), siRNA	~5-20 kDa (ASO); ~100-10,000 kDa (mRNA encapsulated)	IM (mRNA); IV, intrathecal (ASO)
Gene therapy vectors	AAV, lentivirus, adenovirus	~5-100 nm (viral particle size)	IV, local injection
Cell therapies	CAR-T, stem cells, TILs	Live cells (7-15 μm diameter)	IV, local injection

2.2 Production of Biopharmaceuticals

Key steps in biopharmaceutical manufacturing:

Step	Description
Gene cloning	Insert gene of interest into expression vector
Host selection	Choose expression system (E. coli, yeast, CHO cells, etc.)
Transfection/transformation	Introduce vector into host cells
Cell line development	Select high-producing clones; single-cell cloning; stability testing
Upstream processing	Cell culture (batch, fed-batch, perfusion); fermentation
Downstream processing	Purification: capture (protein A for mAbs), polishing (ion exchange, hydrophobic interaction), viral inactivation/removal
Formulation	Buffer, excipients, stabilizers, lyophilization (freeze-drying)
Fill and finish	Sterile filling into vials, pre-filled syringes

Expression systems:

System	Advantages	Disadvantages	Typical products
E. coli (prokaryotic)	High yield (grams/L); fast; low cost; simple genetics	No glycosylation; inclusion bodies; endotoxin	Insulin, growth hormone, cytokines
Yeast (S. cerevisiae, P. pastoris)	Eukaryotic folding; some glycosylation (high mannose); high yield	Glycosylation differs from mammalian	HBV vaccine, insulin, albumin
CHO (Chinese hamster ovary) cells	Human-like glycosylation; high yield (5-10 g/L); stable expression	Slow growth; expensive; viral clearance required	Monoclonal antibodies, EPO, factor VIII
HEK293 (human embryonic kidney)	Human glycosylation; high transfection efficiency (transient)	Lower yield than CHO	Gene therapy vectors (AAV, lentivirus)
Insect cells (baculovirus)	Eukaryotic folding; high yield	Glycosylation different from mammals	Viral vectors (AAV), recombinant proteins

2.3 Monoclonal Antibodies (mAbs)

Definition: Antibodies produced by identical immune cells (clones) that recognize the same epitope on an antigen.

mAb nomenclature (INN suffix -mab):

Suffix	Origin	Example
-omab	Murine (mouse)	Muromonab-CD3 (OKT3)
-ximab	Chimeric (mouse variable + human constant)	Rituximab, infliximab, cetuximab
-zumab	Humanized (mouse CDRs grafted onto human framework; ~90% human)	Trastuzumab, bevacizumab, alemtuzumab
-umab	Fully human	Adalimumab, panitumumab, nivolumab

mAb mechanisms of action:

Mechanism	Description	Examples
Neutralization	Block ligand binding	Adalimumab (anti-TNF), bevacizumab (anti-VEGF), palivizumab (anti-RSV F protein)
Cell depletion (ADCC)	Antibody-dependent cellular cytotoxicity (NK cells via CD16)	Rituximab (anti-CD20), trastuzumab (anti-HER2)
Cell depletion (CDC)	Complement-dependent cytotoxicity	Rituximab (some activity)
Immune checkpoint blockade	Block inhibitory receptors on T cells	Pembrolizumab (anti-PD-1), ipilimumab (anti-CTLA-4), nivolumab (anti-PD-1)
Receptor agonism	Activate receptors	None in clinic yet (in development)
Drug conjugation (ADC)	Deliver cytotoxic payload to cancer cells	Trastuzumab emtansine (T-DM1), brentuximab vedotin (anti-CD30)

Major therapeutic mAbs:

mAb (INN)	Target	Indication	Type	Year approved
Rituximab	CD20 (B cells)	NHL, CLL, rheumatoid arthritis	Chimeric	1997
Trastuzumab	HER2 (ErbB2)	HER2+ breast cancer	Humanized	1998
Infliximab	TNF-α	Crohn’s, RA, UC, psoriasis	Chimeric	1998
Bevacizumab	VEGF-A	Colorectal, lung, renal, glioblastoma	Humanized	2004
Cetuximab	EGFR	Colorectal (KRAS/NRAS/BRAF wt), head/neck	Chimeric	2004
Adalimumab	TNF-α	RA, psoriasis, Crohn’s, UC, many autoimmune	Human	2002
Pembrolizumab	PD-1	Melanoma, NSCLC, many solid tumors (MSI-H, TMB-H)	Humanized	2014
Nivolumab	PD-1	Melanoma, NSCLC, RCC, Hodgkin lymphoma	Human	2014
Ipilimumab	CTLA-4	Melanoma, RCC, NSCLC	Human	2011
Dupilumab	IL-4Rα	Atopic dermatitis, asthma, nasal polyps	Human	2017

2.4 Recombinant Therapeutic Proteins

Protein	Indication	Expression system	Approval year
Insulin (Humulin)	Diabetes mellitus	E. coli	1982
Human growth hormone (hGH, somatropin)	Growth hormone deficiency	E. coli	1985
Erythropoietin (EPO)	Anemia (CKD, chemotherapy)	CHO cells	1989
Interferon-α (IFN-α)	Hepatitis B/C, cancer	E. coli	1986
Factor VIII (anti-hemophilic factor)	Hemophilia A	CHO cells	1992
Tissue plasminogen activator (tPA, alteplase)	Acute ischemic stroke, MI	CHO cells	1987
Glucocerebrosidase (imiglucerase, CEREZYME)	Gaucher disease	CHO cells	1994
Insulin-like growth factor-1 (IGF-1; mecasermin)	Growth failure	E. coli	2005

2.5 Biosimilars

Definition: Biologic medical products that are highly similar to an already approved reference product (originator) with no clinically meaningful differences in safety, purity, and potency.

Key characteristics:

Characteristic	Small-molecule generic	Biosimilar
Structure	Identical to reference	Highly similar (not identical due to complexity)
Process	Chemical synthesis (reproducible)	Biological production (inherent variability)
Regulatory pathway	Abbreviated (ANDA; bioequivalence)	More extensive comparability exercise
Extrapolation	Automatic (same molecule)	Requires scientific justification
Interchangeability	Yes (generic substitution)	Requires additional data (US: interchangeability designation)

Approved biosimilar examples:

Filgrastim-sndz (Zarxio – biosimilar to Neupogen; 2015, first US biosimilar)
Trastuzumab-dkst (Ogivri – biosimilar to Herceptin; 2017)
Adalimumab-adbm (Cyltezo; Humira biosimilar; 2017; interchangeable 2021)
Bevacizumab-awwb (Mvasi; Avastin biosimilar; 2017)

Part 3: Gene Therapy

3.1 Definition and Types

Definition: The introduction of genetic material into a patient’s cells to treat or prevent disease by correcting a genetic defect, providing a missing protein, or killing diseased cells.

Types of Gene Therapy:

Type	Target cells	Heritability	Examples
Somatic gene therapy	Somatic (non-reproductive) cells	Not heritable	Most approved gene therapies (Luxturna, Zolgensma)
Germline gene therapy	Reproductive cells (gametes, zygote)	Heritable	Not permitted (research only; ethical prohibition in most countries)
Ex vivo	Cells removed, modified, returned to patient	Not heritable	CAR-T (Kymriah, Yescarta), Strimvelis (ADA-SCID)
In vivo	Vector administered directly to patient	Not heritable	Luxturna (AAV, subretinal), Zolgensma (AAV9, IV)

3.2 Gene Therapy Vectors

Viral vectors (most common):

Vector	Genome	Capacity	Integration	Duration	Immunogenicity	Examples
Adeno-associated virus (AAV)	ssDNA (~4.7 kb)	~4.5 kb insert	Episomal (mostly)	Years (non-dividing cells)	Low	Luxturna, Zolgensma, Hemgenix
Lentivirus (HIV-based)	ssRNA (~9 kb)	~8-9 kb insert	Integrates into host genome (random)	Permanent (dividing cells)	Moderate	Kymriah, Yescarta (CAR-T ex vivo), Zynteglo (β-thalassemia), Skysona (CALD)
Adenovirus (AdV)	dsDNA (~36 kb)	~8-10 kb insert	Episomal (mostly)	Days-weeks (high immunogenicity)	High	Early gene therapy trials (Jesse Gelsinger) – not approved for gene replacement
Herpes simplex virus (HSV)	dsDNA (~152 kb)	~30 kb insert	Episomal (latent in neurons)	Long-term in neurons	Moderate	Pain management (preclinical), some oncolytic viruses (T-VEC – talimogene laherparepvec)
Retrovirus (γ-retrovirus)	ssRNA (~8 kb)	~7-8 kb insert	Integrates (random)	Permanent	Low-moderate	Early SCID trials (X-linked SCID); risk of insertional mutagenesis (leukemia)

Non-viral vectors:

Vector	Advantages	Disadvantages	Status
Naked DNA/RNA	Low immunogenicity; simple	Low efficiency	In development (mRNA vaccines; CRISPR RNPs)
Lipid nanoparticles (LNPs)	High efficiency for RNA; scalable	Liver accumulation; inflammatory potential	mRNA vaccines; CRISPR (NTLA-2001 – Transthyretin amyloidosis)
Electroporation	Efficient for ex vivo	Cell damage	CAR-T manufacturing
Polymeric nanoparticles (PEI, PLGA)	Tunable; biodegradable	Variable efficiency	Preclinical/clinical trials

3.3 Approved Gene Therapies

Product	Vector	Indication	Approval year
Luxturna (voretigene neparvovec)	AAV2	RPE65 mutation (Leber congenital amaurosis)	2017 (FDA)
Zolgensma (onasemnogene abeparvovec)	AAV9	SMA (spinal muscular atrophy; SMN1 mutation)	2019 (FDA)
Kymriah (tisagenlecleucel)	Lentivirus (ex vivo; CAR-T)	B-ALL (≤25 years), DLBCL	2017 (FDA)
Yescarta (axicabtagene ciloleucel)	Retrovirus (ex vivo; CAR-T)	DLBCL, PMBCL, FL	2017 (FDA)
Zynteglo (betibeglogene autotemcel)	Lentivirus (ex vivo)	β-thalassemia (TDT)	2019 (EMA); 2022 (FDA)
Skysona (elivaldogene autotemcel)	Lentivirus (ex vivo)	CALD (cerebral adrenoleukodystrophy)	2020 (EMA); 2022 (FDA)
Hemgenix (etranacogene dezaparvovec)	AAV5	Hemophilia B (factor IX deficiency)	2022 (FDA, EMA)
Roctavian (valoctocogene roxaparvovec)	AAV5	Hemophilia A (factor VIII deficiency)	2022 (EMA); 2023 (FDA)
CASGEVY (exagamglogene autotemcel; exa-cel)	CRISPR-Cas9 (ex vivo)	Sickle cell disease, transfusion-dependent β-thalassemia	2023 (UK, MHRA); 2024 (FDA)
Lyfgenia (lovotibeglogene autotemcel)	Lentivirus (ex vivo)	Sickle cell disease (with VOC history)	2023 (FDA)

3.4 Challenges in Gene Therapy

Challenge	Description	Solutions
Immunogenicity	Immune response against vector or transgene	Immunosuppression; use of rare serotypes (AAV); cell depletion (ex vivo)
Insertional mutagenesis	Integration near proto-oncogenes (γ-retrovirus, lentivirus – lower risk)	Use of AAV (episomal); safer integration sites (LTR modifications; insulated vectors)
Off-target editing (CRISPR)	Unintended edits at similar genomic sites	High-fidelity Cas9 variants (eSpCas9, SpCas9-HF1); paired nickases; base editing (no DSB)
Delivery efficiency	Transduction of sufficient target cells	High-titer vectors; tissue-specific promoters; improved capsids (directed evolution)
Pre-existing immunity	Neutralizing antibodies against AAV (seroprevalence 30-70% depending on serotype)	Screen patients; use rare serotypes (AAV8, AAV9, AAVrh10); plasmapheresis; immunosuppression
High cost	Millions of dollars per patient	Reimbursement models (annuity payments; outcomes-based agreements)

3.5 CRISPR-Cas9 Gene Editing

Components:

Cas9 protein: Endonuclease (creates double-strand break – DSB)
Single guide RNA (sgRNA): Combines crRNA (target recognition, 20 nt spacer + scaffold) and tracrRNA (scaffold)

DNA repair pathways:

Pathway	Mechanism	Outcome	Applications
Non-homologous end joining (NHEJ)	Error-prone ligation of DSB ends (indels)	Gene disruption (frameshift, knockout)	Knockout (e.g., CCR5 for HIV resistance)
Homology-directed repair (HDR)	Precise repair using donor template (sister chromatid or exogenous)	Gene correction; knock-in	Gene therapy for monogenic diseases (sickle cell, β-thalassemia)

CRISPR-based therapies in clinic:

Exa-cel (CTX001): Ex vivo edited CD34+ cells (HSCs); knockout of BCL11A enhancer → reactivate fetal hemoglobin (HbF) → treat sickle cell disease and β-thalassemia (approved 2023/2024)
NTLA-2001 (Intellia/Regeneron): In vivo LNP delivery of CRISPR to liver; knockout of TTR (transthyretin) → treat ATTR amyloidosis (in clinical trials; Phase 1 completed; Phase 3 ongoing as of 2024)
VERVE-101: Base editing (adenine base editor – ABE) to inactivate PCSK9 in liver → lower LDL cholesterol (PCSK9 knockout; Phase 1; paused due to safety events)

CRISPR-Cas variants:

Variant	Mechanism	Advantages	Applications
Base editing (BE)	Deaminase converts one base to another (C→T, A→G) without DSB	No DSB; high efficiency; fewer indels	Point mutations (e.g., PCSK9, TTR)
Prime editing (PE)	Cas9 nickase + reverse transcriptase (RT) with prime editing guide RNA (pegRNA) – writes new sequence	All 12 base-to-base conversions; small insertions/deletions	Flexible editing without donor DNA
Cas12a (Cpf1)	Smaller; creates staggered cut (5′ overhangs)	Different PAM (TTTV); simpler multiplexing (processes its own crRNA)	Alternative to Cas9
Cas13	RNA-targeting (not DNA)	RNA editing (temporary)	Antiviral; RNA knockdown

Part 4: Cell Therapy

4.1 Chimeric Antigen Receptor (CAR) T-Cell Therapy

Definition: Autologous T cells engineered to express a synthetic receptor (CAR) that recognizes a tumor antigen independent of MHC (major histocompatibility complex).

CAR structure:

Generation	Components	Features
1st generation	Extracellular scFv (single-chain variable fragment) + hinge + transmembrane + CD3ζ signaling domain	Limited persistence; poor efficacy
2nd generation	1st generation + costimulatory domain (CD28 or 4-1BB)	Improved persistence; clinical efficacy (approved CAR-T cells)
3rd generation	2nd generation + second costimulatory domain (CD28 + 4-1BB or OX40)	Enhanced activation (theoretical; not clearly superior)
4th generation (TRUCK)	2nd generation + cytokine transgene (e.g., IL-12)	Remodel tumor microenvironment
5th generation (UniCAR)	Split, universal, switchable CAR	Improved safety; multiple antigens

Approved CAR-T therapies:

Product	Target	Indication	Costimulatory domain	Approval year
Kymriah (tisagenlecleucel)	CD19	B-ALL (≤25 years), DLBCL, FL	4-1BB	2017
Yescarta (axicabtagene ciloleucel)	CD19	DLBCL, PMBCL, FL	CD28	2017
Tecartus (brexucabtagene autoleucel)	CD19	Mantle cell lymphoma (MCL), B-ALL (adults)	CD28	2020
Breyanzi (lisocabtagene maraleucel)	CD19	DLBCL, PMBCL, FL, MCL	4-1BB	2021
Abecma (idecabtagene vicleucel)	BCMA	Multiple myeloma	CD28	2021
Carvykti (ciltacabtagene autoleucel)	BCMA	Multiple myeloma (≥4 prior therapies)	4-1BB + CD28	2022

Manufacturing process (autologous CAR-T):

Leukapheresis: Collect patient T cells (apheresis)
Activation: Stimulate T cells (anti-CD3/CD28 beads)
Transduction: Lentiviral or retroviral vector (CAR gene)
Expansion: Grow to therapeutic dose (hundreds of millions to billions of cells)
Formulation: Cryopreserve; quality control
Infusion: Thaw; administer to patient (after lymphodepletion – cyclophosphamide + fludarabine)

Toxicity management:

Toxicity	Symptoms	Management
Cytokine release syndrome (CRS)	Fever, hypotension, hypoxia, capillary leak, organ dysfunction (IL-6 mediated)	Tocilizumab (anti-IL-6R), corticosteroids; supportive care (fluids, vasopressors, oxygen)
Immune effector cell-associated neurotoxicity syndrome (ICANS)	Confusion, aphasia, seizures, cerebral edema	Corticosteroids; supportive care; anakinra (IL-1R antagonist)
B-cell aplasia / hypogammaglobulinemia	Increased infection risk (due to CD19-targeted CAR-T)	IVIG replacement; vaccination (inactivated vaccines)
Tumor lysis syndrome (TLS)	Metabolic disturbances (hyperuricemia, hyperkalemia, hyperphosphatemia, hypocalcemia)	Allopurinol, rasburicase; hydration

4.2 Stem Cell Therapy

Cell type	Source	Differentiation potential	Ethical concerns	Clinical applications
Embryonic stem cells (ESC)	Inner cell mass of blastocyst (embryo days 5-7)	Pluripotent (all cell types)	Destruction of embryo; moral status	Age-related macular degeneration (AMD), spinal cord injury (clinical trials, limited efficacy; safety concerns – teratomas)
Induced pluripotent stem cells (iPSC)	Adult somatic cells reprogrammed (Yamanaka factors: Oct4, Sox2, Klf4, c-Myc ± Lin28, Nanog)	Pluripotent	Minimal (no embryo)	Disease modeling; drug screening; autologous therapy (retinal pigment epithelium – RPE; Parkinson’s; clinical trials in Japan, US)
Mesenchymal stem cells (MSC)	Bone marrow, adipose tissue, umbilical cord	Multipotent (mesoderm: bone, cartilage, fat, muscle)	Minimal	Graft-versus-host disease (GVHD; remestemcel-L – Prochymal, approved in Canada, New Zealand; not FDA-approved), osteoarthritis (clinical trials), Crohn’s fistula
Hematopoietic stem cells (HSC)	Bone marrow, peripheral blood (mobilized with G-CSF), umbilical cord blood	Multipotent (blood cells)	Minimal	HSCT (bone marrow transplant) for hematologic malignancies (leukemia, lymphoma), bone marrow failure, hemoglobinopathies (SCD, thalassemia – exa-cel, Lyfgenia, Zynteglo)

Stem Cell Niches in the Body: Bone marrow (HSCs), skin (bulge region), intestine (crypt base), brain (subventricular zone, hippocampus).

4.3 Induced Pluripotent Stem Cells (iPSCs)

Yamanaka factors (Oct4, Sox2, Klf4, c-Myc): Transcription factors that reprogram somatic cells to pluripotency.

Factor	Function
Oct4 (POU5F1)	Maintain pluripotency (essential)
Sox2 (SRY-box 2)	Maintain pluripotency; cooperate with Oct4
Klf4 (Kruppel-like factor 4)	Maintain pluripotency; tumor suppressor? (but also c-Myc cooperation in reprogramming)
c-Myc	Proliferation; chromatin remodeling (but oncogene)

Reprogramming methods:

Integrating (retrovirus, lentivirus – stable, insertional mutagenesis risk)
Non-integrating (Sendai virus, episomal plasmids, mRNA, synthetic proteins, small molecules – safer)

Applications:

Disease modeling (patient-specific iPSC → differentiate to affected cell type)
Drug screening (high-throughput; isogenic controls via gene editing)
Autologous cell therapy (iPSC → differentiated cells → transplant back to patient)
Toxicology testing (cardiotoxicity, hepatotoxicity)

Part 5: Vaccines and Immunotherapy

5.1 Vaccine Types

Type	Description	Examples	Advantages	Disadvantages
Live attenuated	Weakened (avirulent) pathogen	MMR, varicella, yellow fever, oral polio (OPV), BCG	Strong, durable immunity	Safety (reversion to virulence) – risk in immunocompromised; requires cold chain
Inactivated (killed)	Chemically or heat-inactivated pathogen	Inactivated polio (IPV), rabies, hepatitis A, influenza (injected)	Safe (no reversion); stable	Lower immunogenicity (requires adjuvants, boosters)
Subunit (recombinant protein)	Purified antigen (produced in heterologous system – E. coli, yeast, CHO)	HBV (HBsAg; yeast), HPV (L1 VLP; yeast/insect cells), acellular pertussis (aP), Novavax COVID-19 (spike protein – insect cells)	Safe; well-defined	Requires adjuvants; multiple doses
Viral vector (replicating)	Modified virus (different backbone) expressing antigen	Ebola (rVSV-ZEBOV – Vesicular stomatitis virus), COVID-19 (Janssen – Ad26; Sputnik V – Ad26+Ad5; CanSino – Ad5)	Strong T cell response	Pre-existing immunity to vector (Ad5 seroprevalence)
Viral vector (non-replicating)	Replication-deficient virus (often Ad, poxvirus) expressing antigen	COVID-19 (AstraZeneca – ChAdOx1 (chimpanzee adenovirus)), Oxford/AstraZeneca; Sputnik V (recombinant Ad26/Ad5 – prime/boost)	Safer (no replication)	Requires higher dose; manufacturing complexity
Nucleic acid (mRNA)	mRNA encoding antigen encapsulated in LNP	COVID-19 (Pfizer/BioNTech – BNT162b2; Moderna – mRNA-1273)	Rapid design; high efficacy; scalable	Cold chain (ultra-low for Pfizer: -70°C); novel platform (long-term data limited at time of EUA)
Nucleic acid (DNA)	Plasmid DNA (electroporation or IM)	COVID-19 (ZyCoV-D – India; plasmid DNA with electroporation device approved in India; Zydus Cadila)	Stable; simple production	Low immunogenicity (requires electroporation or needle-free delivery)
Virus-like particle (VLP)	Viral structural proteins self-assemble into non-infectious particles (resemble virus)	HPV (Gardasil, Cervarix), HBV (Recombivax HB, Engerix-B), malaria (RTS,S/AS01 – Mosquirix – hepatitis B surface antigen + P. falciparum circumsporozoite protein (CSP) VLP)	Safe; repetitive epitopes (immunogenic)	Complex manufacturing

5.2 mRNA Vaccines (Platform Technology)

Feature	Pfizer/BioNTech (BNT162b2, COMIRNATY)	Moderna (mRNA-1273, SPIKEVAX)
mRNA modifications	1-methylpseudouridine (1mΨ; reduced TLR7/8 activation); codon optimization	Same (1mΨ)
Lipid nanoparticle (LNP) composition	Ionizable lipid (ALC-0315), DSPC, cholesterol, PEG-lipid	Ionizable lipid (SM-102), DSPC, cholesterol, PEG-lipid
Storage	-70°C (ultra-cold; 2-8°C for limited time)	-20°C (2-8°C for 30 days)
Efficacy (original strain)	~95% (Phase 3)	~94% (Phase 3)

Mechanism:
LNP (lipid nanoparticle) delivers mRNA to cytoplasm (after endosomal escape) → ribosome translates mRNA to spike protein (S protein) → antigen presentation (MHC I (endogenous; cross-presentation via dendritic cells) and MHC II (exogenous after uptake by antigen-presenting cells)) → antibody (B cell) and T cell (CD4+, CD8+) responses.

Advantages of mRNA platform:

Rapid design (sequence from pathogen to clinical trials in weeks)
Scalable manufacturing (cell-free; in vitro transcription; enzymatic capping)
No risk of integration (transient expression)
Can be adapted rapidly to new variants (updated vaccines within 3-4 months)

5.3 Cancer Immunotherapy

Therapy	Mechanism	Examples	Indications
Immune checkpoint inhibitors (ICI)	Block inhibitory receptors on T cells (PD-1, PD-L1, CTLA-4)	Pembrolizumab (Keytruda, anti-PD-1), nivolumab (Opdivo, anti-PD-1), ipilimumab (Yervoy, anti-CTLA-4), atezolizumab (Tecentriq, anti-PD-L1)	Melanoma, NSCLC, RCC, bladder, MSI-H tumors
CAR-T cells	Engineered T cells with synthetic receptor	Kymriah, Yescarta, Tecartus, Breyanzi, Abecma, Carvykti	Hematologic malignancies (CD19, BCMA)
Tumor-infiltrating lymphocytes (TIL)	Expanded autologous TILs	Lifileucel (LN-144)	Melanoma (approved 2024, Iovance Biotherapeutics; accelerated approval)
Bispecific T cell engagers (BiTE)	Bispecific antibody (CD3 × tumor antigen)	Blinatumomab (Blincyto; CD3×CD19)	B-ALL
Oncolytic viruses	Replicate selectively in cancer cells (lyse); stimulate immune response	T-VEC (talimogene laherparepvec; HSV-1 modified; GM-CSF transgene)	Melanoma (intralesional)
Cancer vaccines	Peptide, protein, or nucleic acid encoding tumor antigens	Sipuleucel-T (Provenge; autologous dendritic cell vaccine loaded with PAP (prostatic acid phosphatase) – approved 2010 for prostate cancer; patient-specific)	Prostate cancer (sipuleucel-T – autologous DC vaccine); others in development (personalized neoantigen vaccines, mRNA-4157 (V940) – Moderna/Merck)

Part 6: Diagnostics and Personalized Medicine

6.1 Molecular Diagnostics

Platform	Method	Detection limit	Applications
PCR (endpoint)	DNA amplification (thermal cycling); gel electrophoresis	~10-100 copies/μL	Pathogen detection (qualitative)
qPCR (real-time PCR)	Fluorescent detection during amplification (SYBR Green, TaqMan probe)	~10 copies/μL	Viral load (quantitative); gene expression
Digital PCR (dPCR)	Partition sample into thousands of droplets (endpoint fluorescence)	Absolute quantification; ~1-5 copies/μL	Rare mutation detection; copy number variation
Multiplex PCR	Multiple primer pairs; amplicon size discrimination or probe colors	Variable	Respiratory pathogen panels; genotyping
LAMP (loop-mediated isothermal amplification)	Isothermal (60-65°C); high specificity (4-6 primers)	~10-100 copies	Point-of-care (COVID-19, malaria, TB)
CRISPR-based detection (SHERLOCK, DETECTR)	Cas13 (SHERLOCK) or Cas12 (DETECTR) + reporter cleavage (fluorescent or lateral flow)	Attomolar (aM) sensitivity	Ultra-sensitive nucleic acid detection
ELISA (enzyme-linked immunosorbent assay)	Antibody binding; enzyme-amplified

BTH-4261: Marine Biotechnology – Comprehensive Study Notes

Marine Biotechnology is the application of scientific and engineering principles to the processing of marine biological resources for the production of goods and services. This field harnesses the vast, largely unexplored biodiversity of the oceans—from microorganisms to macroalgae and vertebrates—to develop innovative solutions for pharmaceuticals, cosmetics, biofuels, food security, and environmental remediation.

Marine biotechnology merges the principles of classical biotechnology with the unique adaptations of marine organisms (e.g., psychrophiles, halophiles, organisms living under extreme pressure), offering novel biomolecules and metabolic pathways not found in terrestrial life.

Part 1: Foundations of Marine Biotechnology

1.1 What is Marine Biotechnology?

Marine Biotechnology is defined as the use of living marine organisms, or parts thereof, to develop or make products, or to modify marine plants and animals for specific uses. It is an emerging field with highly promising potential in terms of innovation and economic benefits, particularly as we face the challenges of the “Blue Economy”.

Key Insight: Marine biotechnology is not limited to fishing or aquaculture. It encompasses bioprospecting—the systematic search for and development of new sources of chemical compounds, genes, and other valuable products from marine biodiversity.

1.2 Importance of the “Blue Economy” & Bioprospecting

The global ocean represents over 90% of the biosphere by volume. This immense living space contains a taxonomic and genetic diversity that far exceeds that of terrestrial environments. Marine bioprospecting is a key economic driver because:

Biodiversity Hotspots: Coral reefs, deep-sea vents, and polar seas harbor organisms with unique metabolic pathways.
Novel Compounds: Due to the harsh conditions (high pressure, cold, dark), marine organisms produce unique secondary metabolites for defense and communication (e.g., sponges, tunicates, mollusks).
Patent Landscape: Marine-derived compounds are being patented for use in cancer treatment, anti-inflammatory drugs, and industrial enzymes.

1.3 Course Scope (Curriculum Integration)

Based on curricula like the one outlined for Master’s programs in Marine Biotechnology, the field integrates several critical disciplines:

Domain	Key Topics	Application
Marine Ecology & Systematics	Diversity of marine micro/macro organisms, taxonomy	Identifying target organisms for bioprospecting
Molecular & Genetic Engineering	Gene cloning, expression systems, omics technologies	Producing recombinant marine proteins
Microbial Biotechnology	Isolation, culture, and utilization of marine microbes	Bioremediation, probiotics, enzyme production
Bioprocess Engineering	Fermentation, downstream processing, bioreactors	Scaling up production of marine metabolites
Bioinformatics & Omics	Genomics, proteomics, data analysis	Identifying biosynthetic gene clusters

Part 2: Marine Biological Resources

Marine organisms have evolved unique physiological and biochemical adaptations.

2.1 Systematics of Marine Life

To effectively utilize marine resources, one must understand their classification and biology.

A. Marine Microorganisms (Diversity and Systematics)

Bacteria: Dominant decomposers and primary producers in some niches (e.g., Cyanobacteria). Key for biogeochemical cycles.
Archaea: Often extremophiles (hyperthermophiles, psychrophiles). Source of unique enzymes (extremozymes).
Microalgae (Phytoplankton): Diatoms, Dinoflagellates, Coccolithophores. High lipid content (potential for biofuels).
Fungi: Marine yeasts and molds, capable of degrading complex polymers (cellulose, chitin) under saline conditions.

B. Marine Plants (Systematics)

Macroalgae (Seaweeds): Multicellular, photosynthetic organisms found in intertidal and subtidal zones.
- Chlorophyta (Green Algae): Ulva (Sea lettuce).
- Phaeophyta (Brown Algae): Laminaria, Sargassum. Source of Alginates.
- Rhodophyta (Red Algae): Porphyra (Nori), Gelidium. Source of Agar and Carrageenan.
Seagrasses: Flowering plants (Angiosperms) adapted to saline environments. Important for coastal ecosystem stability.

C. Marine Invertebrates (Systematics) and Vertebrates

Invertebrates: Sponges (Porifera), Cnidarians (Jellyfish, corals), Mollusks (Mussels, Squid), Crustaceans (Crabs, Shrimp), Echinoderms (Starfish).
- Role in Biotech: Sponges produce anti-cancer compounds (e.g., Halichondrin B); Crustacean shells are sources of Chitin.
Vertebrates: Fish (Teleosts, Elasmobranchs – sharks, rays) and Marine Mammals. Sources of collagen, fish oil (Omega-3 fatty acids), and bioactive peptides.

2.2 Marine Physiology and Ecophysiology

Understanding how marine organisms function under stress is key to applying biotechnology.

Osmotic Regulation: Mechanisms for surviving varying salinity.
Pressure Adaptation (Piezophiles): Enzymes that function optimally at high pressure (deep sea).
Temperature Adaptation (Psychrophiles): Cold-adapted enzymes (high catalytic efficiency at low temperatures) used in detergents and molecular biology.

Part 3: Tools and Techniques in Marine Biotechnology

Modern marine biotechnology relies heavily on the techniques of molecular biology, genetic engineering, and analytical chemistry.

3.1 Genetic Engineering and Molecular Biology

Metagenomics: Extraction and sequencing of DNA directly from environmental samples (e.g., sea water, sediment) without culturing the organisms. Used to discover novel genes (e.g., antibiotic resistance genes, novel polymerases).
Cloning and Expression: Inserting marine-derived genes into host cells (E. coli, yeast) to produce high-value proteins (e.g., Green Fluorescent Protein – GFP from jellyfish, Aequorea victoria).
Cell Culture: Growing marine invertebrate or algal cells in vitro to produce bioactive compounds without harvesting wild populations.

3.2 Instrumental Analysis Techniques

Identification of marine natural products requires sophisticated chemistry.

Chromatography: HPLC, GC-MS for separating complex mixtures of compounds.
Spectroscopy: NMR (Nuclear Magnetic Resonance) for structural elucidation of unknown compounds.
Mass Spectrometry (MS): For determining molecular weight and identifying chemical structures.

3.3 Bioprocesses and Engineering

Fermentation: Culturing marine microorganisms (e.g., Vibrio, Pseudoalteromonas) in bioreactors to harvest enzymes or antibiotics.
Downstream Processing: Extraction, purification, and formulation of the target product (e.g., alginate from seaweed).

Part 4: Applied Marine Biotechnology

The ultimate goal of marine biotechnology is the valorization (adding value) of marine bioresources for commercial use in various sectors.

4.1 Pharmaceuticals (Blue Pharma)

Marine organisms are a rich source of novel drug leads.

Anti-cancer agents:
- Trabectedin (Yondelis®): Derived from the sea squirt Ecteinascidia turbinata. Used for soft tissue sarcoma.
- Brentuximab vedotin (Adcetris®): Uses a compound derived from the sea hare Dolabella auricularia.
Analgesics: Ziconotide (Prialt®) – a synthetic version of a cone snail peptide (ω-conotoxin) used for severe chronic pain.
Anti-inflammatory compounds: Pseudopterosins from the sea whip Pseudopterogorgia elisabethae (used in cosmetics as well).
Toxicological and Pharmacological Controls: Assessment of bioactivity and toxicity of marine-derived compounds before clinical trials.

4.2 Cosmeceuticals (Marine Ingredients in Cosmetics)

Mycosporine-like Amino Acids (MAAs): UV-absorbing compounds from algae and cyanobacteria used as natural sunscreens.
Marine Collagen and Elastin: Derived from fish skin and scales (waste valorization). Used in anti-aging creams.
Alginate and Carrageenan: Used as thickening and stabilizing agents in creams and lotions.

4.3 Nutraceuticals and Functional Foods

Omega-3 Fatty Acids (EPA/DHA): Produced from microalgae (e.g., Schizochytrium, Crypthecodinium) rather than fish oil (sustainable alternative). Used in heart health supplements.
Antioxidants: Fucoxanthin (brown algae), Astaxanthin (microalgae) – used to boost immune function and reduce inflammation.
Probiotics: Using marine bacteria (e.g., Bacillus spp.) to improve health in aquaculture settings (shrimp, fish farms).

4.4 Marine Enzymes and Biofuels

Industrial Enzymes:
- Psychrophilic enzymes: Cold-active proteases and lipases used in “cold-water” detergents to save energy.
- Halophilic enzymes: Tolerant to high salt, used in harsh industrial processes.
- DNA Polymerases: Pfu polymerase from Pyrococcus furiosus (hyperthermophilic archaeon) used in PCR (High Fidelity).
Biofuels:
- Third-generation biofuels: Using microalgae to produce biodiesel (high lipid content) and bioethanol (from carbohydrate-rich algae).
- Biogas: Anaerobic digestion of macroalgae (seaweed) to produce methane.

Part 5: Environmental Marine Biotechnology

This area focuses on using biotechnology to solve pollution problems in the oceans.

5.1 Bioremediation and Decontamination

Bioprocesses for the decontamination and bioremediation of marine environments are critical.

Oil Spill Cleanup: Using Hydrocarbonoclastic bacteria (e.g., Alcanivorax, Oleispira) that naturally degrade petroleum hydrocarbons. Biostimulation (adding nutrients) and Bioaugmentation (adding specific bacteria) are key strategies.
Heavy Metal Remediation: Using macroalgae (Sargassum) or bacteria to biosorb (absorb) heavy metals like Lead (Pb), Mercury (Hg), and Cadmium (Cd) from industrial effluent.
Plastic Degradation: Discovery of marine microorganisms (bacteria, fungi) capable of degrading plastics (e.g., PETase enzyme from Ideonella sakaiensis).
Eutrophication Control: Using seaweed farming to absorb excess Nitrogen and Phosphorus from coastal waters (nutrient bioextraction).

5.2 Biocorrosion and Antifouling

Biocorrosion (Microbiologically Influenced Corrosion – MIC): Biofilms of sulfate-reducing bacteria (e.g., Desulfovibrio) accelerate the corrosion of steel pipelines and ship hulls. Marine biotechnologists work on inhibitors to prevent this.
Antifouling: Biofouling (attachment of barnacles, mussels, algae) is a major economic problem for shipping. Biotechnology develops natural antifouling compounds (e.g., from sponges or corals) to replace toxic heavy metals (like Tributyltin – TBT).

Part 6: Key Terms and Concepts (Glossary)

Term	Definition
Bioprospecting	The systematic search for and development of new sources of chemical compounds, genes, and other valuable products from marine biodiversity.
Blue Economy	The sustainable use of ocean resources for economic growth, improved livelihoods, and jobs while preserving the health of ocean ecosystems.
Valorization	The process of converting biological waste materials or raw biomass into more valuable products (e.g., converting fish waste into collagen or chitin).
Metagenomics	The study of genetic material recovered directly from environmental samples (e.g., seawater) without the need for laboratory culturing.
Psychrophile	An organism that thrives at low temperatures (approx. -20°C to +10°C).
Piezophile	An organism that thrives under high hydrostatic pressure (deep-sea environments).
Halophile	An organism that thrives in high salt concentrations (e.g., salt lakes, sea water).
Bioremediation	The use of microorganisms (e.g., bacteria, fungi) or plants to detoxify or remove pollutants from the environment.
Aquaculture	The farming of fish, crustaceans, mollusks, and aquatic plants.
Bioactive Compound	A substance that has a biological effect on living tissue (e.g., anti-cancer, anti-inflammatory).
Extremozyme	An enzyme that is stable and active under extreme conditions (high temperature, high salt, high pressure).
Chitin	A long-chain polymer of N-acetylglucosamine; the main component of the exoskeletons of crustaceans and insects.
Alginate	A polysaccharide extracted from brown algae, used as a thickening agent and in wound dressings.
Halichondrin B	A potent anti-cancer agent originally isolated from the marine sponge Halichondria okadai.
Hydrocarbonoclastic Bacteria	Specialized bacteria that utilize hydrocarbons (oil) as a source of carbon and energy.

Summary Table: Marine Organisms and Their Biotech Products

Organism	Source	Biotech Product / Application
Microalgae	Phytoplankton	Omega-3 fatty acids (EPA/DHA), Biofuels (Lipids), Astaxanthin (Antioxidant)
Macroalgae (Seaweed)	Brown, Red, Green	Alginates (Thickener), Carrageenan (Gelling agent), Agar (Microbiology media), Food source
Marine Sponges	Halichondria, Tethya	Anti-cancer agents (Halichondrin B), Antiviral compounds (Ara-A)
Cone Snails	Conus magus	Ziconotide (Pain killer – Prialt®)
Sea Squirts (Tunicates)	Ecteinascidia	Trabectedin (Soft tissue sarcoma drug – Yondelis®)
Jellyfish	Aequorea victoria	Green Fluorescent Protein (GFP) – Used as a molecular marker in genetic engineering
Marine Bacteria	Pyrococcus, Thermus, Alcanivorax	DNA Polymerases (PCR), restriction enzymes, Oil spill cleanup
Marine Fungi	Sediments, Sponges	Antibiotics, Enzymes (Cellulases, Lipases) for biomass conversion
Crustaceans	Shrimp, Crab shells	Chitin / Chitosan (Wound healing, water treatment, dietary fiber)

Exam Preparation Questions

Short Answer Questions

Define Marine Biotechnology and differentiate it from traditional aquaculture.
What is “Bioprospecting” and why are deep-sea hydrothermal vents a major target for bioprospectors?
List three major groups of Macroalgae (Seaweeds) and one commercial product derived from each.
What are Psychrophilic enzymes? Give an example of an industrial application.
Explain the term “Bioremediation” and describe how Alcanivorax bacteria are used in oil spill cleanups.

Long Answer Questions

Describe the process of utilizing microalgae for third-generation biofuel production. What are the advantages of using algae over terrestrial crops (like corn or sugarcane) for biodiesel?
Discuss the significance of the marine environment for pharmaceutical drug discovery. Name two marine-derived drugs currently used in human medicine and specify the source organism.
Explain the concept of “Blue Economy”. How does marine biotechnology contribute specifically to the economic sustainability and environmental health of our oceans?
What are the primary challenges in scaling up the production of marine-derived compounds from discovery (lab scale) to industrial production (bioprocessing)?
Detail the step-by-step process for isolating Chitin from crustacean shells (e.g., shrimp waste). List the chemical treatments involved and the potential industrial applications of Chitosan.

Study Tip: The key to mastering Marine Biotechnology is to remember that the ocean is a chemical library. For every unique habitat (deep sea vent, coral reef, polar ice), there is a unique organism with unique enzymes and metabolites. When studying a specific marine natural product (e.g., Trabectedin), ask yourself: Why does this sea squirt produce this toxin? (Predator defense). How do we harvest it without killing the ecosystem? (Chemical synthesis / Cell culture). This “Evolutionary Reason” approach will help you retain the information better than rote memorization.

BTH-4292 Fungal Biotechnology – Study Notes

1. Core Concepts & Scope

Fungal Biotechnology: The application of fungi (molds, yeasts, mushrooms) and their metabolic products for industrial, agricultural, environmental, and medical purposes. It harnesses the unique metabolic diversity and enzymatic capabilities of fungi for the production of valuable products and processes .
Key Distinction: Fungal biotechnology differs from bacterial biotechnology in its reliance on eukaryotic metabolic pathways, post-translational modification capabilities, and the ability to produce a wider range of secondary metabolites (e.g., antibiotics, mycotoxins) .
Why Fungi Matter:
- Industrial workhorses: Production of enzymes, organic acids, antibiotics, and recombinant proteins.
- Food security: Fermented foods (bread, cheese, soy sauce, tempeh) and edible mushrooms.
- Environmental solutions: Bioremediation, mycoremediation, biological control of pests.
- Model organisms: Saccharomyces cerevisiae (yeast) and Aspergillus nidulans (filamentous fungus) for genetic and cell biology studies.

Major Areas of Fungal Biotechnology

Area	Description	Examples
Industrial Mycology	Large-scale production of fungal products	Citric acid (Aspergillus niger), antibiotics (Penicillium chrysogenum), enzymes (Trichoderma reesei)
Food Mycology	Fermented foods, mushrooms, single-cell protein	Bread, cheese, tempeh, Saccharomyces cerevisiae (baker’s yeast), Agaricus bisporus (button mushroom)
Medical Mycology	Production of pharmaceuticals, diagnostics	Penicillin, statins (lovastatin), cyclosporine; antifungal drug discovery
Agricultural Mycology	Biopesticides, plant growth promotion, mycorrhizae	Trichoderma (biocontrol), Beauveria bassiana (entomopathogen), arbuscular mycorrhizal (AM) fungi
Environmental Mycology	Bioremediation, wastewater treatment, mycoremediation	White-rot fungi (Phanerochaete chrysosporium) for lignin and pollutant degradation
Genetic Engineering	Transformation, heterologous protein expression	Yeast expression systems (Pichia pastoris, S. cerevisiae); CRISPR/Cas9 in filamentous fungi

2. Fungal Biology and Diversity

2.1 Major Fungal Groups Relevant to Biotechnology

Group	Characteristics	Biotechnological Importance
Ascomycota (sac fungi)	Septate hyphae; produce ascospores; includes yeasts (unicellular) and filamentous forms	Saccharomyces cerevisiae (baking, brewing, genetic model); Aspergillus spp. (enzymes, organic acids); Penicillium spp. (antibiotics); Trichoderma (enzymes, biocontrol)
Basidiomycota (club fungi)	Septate hyphae; produce basidiospores; includes mushrooms, puffballs, rusts, smuts	Edible and medicinal mushrooms (Agaricus, Pleurotus, Lentinula); white-rot fungi (Phanerochaete) for lignin degradation; heterologous protein expression
Zygomycota (conjugation fungi)	Coenocytic (aseptate) hyphae; produce zygospores	Rhizopus spp. (organic acids, enzymes, tempeh fermentation); Mucor spp. (enzymes, steroids)
Yeasts (polyphyletic)	Unicellular; reproduce by budding or fission	Saccharomyces cerevisiae (model organism, ethanol fermentation); Pichia pastoris (recombinant protein expression); Yarrowia lipolytica (lipid production)

2.2 Fungal Growth and Metabolism

Growth Form	Description	Applications
Filamentous (mycelial)	Network of hyphae; penetrates solid substrates; produces extracellular enzymes	Submerged fermentations (enzymes, antibiotics); solid-state fermentation (SSF) for enzymes and spores
Yeast (unicellular)	Single cells; grows in liquid or on surfaces; high surface-to-volume ratio	Suspension cultures (ethanol, recombinant proteins); easy genetic manipulation
Dimorphic	Switch between yeast and filamentous forms in response to environment	Pathogenic fungi (e.g., Candida albicans); industrial relevance in Yarrowia lipolytica

Growth Phases in Submerged Fermentation:

Lag phase: Adaptation to medium (synthesis of enzymes, no growth).
Log (exponential) phase: Rapid growth; primary metabolite production.
Stationary phase: Growth ceases (nutrient limitation); secondary metabolite production (antibiotics, pigments).
Death phase: Biomass declines; cell lysis releases intracellular products.

3. Fungal Fermentation Technology

3.1 Types of Fermentation Processes

Fermentation Type	Substrate	Advantages	Disadvantages	Examples
Submerged Fermentation (SmF)	Liquid medium (soluble substrates)	Easy to scale up; homogeneous culture; online monitoring possible	High water usage; downstream processing costs; shear stress sensitive	Penicillium (penicillin); Aspergillus (citric acid); S. cerevisiae (ethanol)
Solid-State Fermentation (SSF)	Solid substrate with low moisture (e.g., grains, bran, agricultural residues)	High volumetric productivity; low water usage; mimics natural habitat; lower energy	Difficult to scale up; mixing challenges; heat transfer issues	Trichoderma (enzymes); Rhizopus (tempeh); Aspergillus (kojic acid)

3.2 Bioreactor Design for Fungi

Bioreactor Type	Mixing	Oxygen Transfer	Shear Sensitivity	Best For
Stirred-tank reactor (STR)	Mechanical impeller	High (sparger + agitation)	High (can damage hyphae)	Yeasts; pellet-forming filamentous fungi (if agitation optimized)
Air-lift (bubble column)	Pneumatic (air injection)	Moderate	Low	Shear-sensitive filamentous fungi (e.g., Penicillium)
Packed-bed (SSF)	Static (no mixing)	Passive (diffusion)	None (static)	Solid-state fermentation; enzyme production
Fluidized bed	Fluidized by liquid/gas flow	Moderate	Low to moderate	Immobilized cells; yeast; pellet cultures

Morphology in submerged cultures of filamentous fungi:

Pellet form: Compact spherical hyphal aggregates (good for oxygen transfer, lower viscosity).
Clumped (dispersed) mycelium: High viscosity, mixing problems, often lower productivity.
Controlled by: pH, inoculum density, medium composition, agitation speed.

3.3 Downstream Processing of Fungal Products

Product Type	Harvesting / Recovery	Purification
Extracellular (e.g., enzymes, organic acids, antibiotics)	Biomass separation (filtration, centrifugation); supernatant recovery	Precipitation (ammonium sulfate, solvent); chromatography (IEX, affinity); crystallization
Intracellular (e.g., pigments, lipids)	Biomass harvest → cell disruption (bead mill, homogenizer, enzymatic lysis)	Solvent extraction; chromatography
Spores (biopesticides)	Harvest from SSF; dry (air, lyophilization)	Formulation with carriers (talc, clay, oils)

4. Fungal Enzymes (Industrial Enzymology)

4.1 Major Fungal Enzymes and Applications

Enzyme Class	Specific Enzyme	Fungal Source	Application
Carbohydrases	Amylase (α-amylase, glucoamylase)	Aspergillus niger, A. oryzae	Starch hydrolysis (bread, brewing, glucose syrup production)
	Cellulase (endoglucanase, exoglucanase, β-glucosidase)	Trichoderma reesei, Aspergillus niger	Cellulose degradation (biofuels, textile, paper, animal feed)
	Xylanase	Trichoderma, Aspergillus	Pulp and paper bleaching; biofuel production; animal feed
	Pectinase	Aspergillus niger	Juice clarification; wine production; fruit processing
Proteases	Acid, neutral, alkaline proteases	Aspergillus oryzae, A. niger, Rhizopus	Detergents (alkaline); meat tenderization; cheese making; baking
Lipases	Lipases, phospholipases	Candida rugosa, Rhizopus oryzae, Thermomyces lanuginosus	Biodiesel production; detergent; food processing; ester synthesis
Lignin-modifying enzymes	Lignin peroxidase (LiP), manganese peroxidase (MnP), laccase	Phanerochaete chrysosporium, Trametes versicolor, Pleurotus ostreatus	Pulp delignification; textile dye decolorization; bioremediation
Oxidoreductases	Glucose oxidase (GOX)	Aspergillus niger	Food preservative; biosensors (glucose detection)
	Catalase	Aspergillus niger	Food processing; hydrogen peroxide decomposition

4.2 Enzyme Production Strategies

Strategy	Description	Examples
Homologous expression (natural host)	Use wild-type or mutated (strain improvement) fungal strain	Classical strain improvement (mutagenesis + screening) for Penicillium (penicillin), Aspergillus (citric acid)
Heterologous expression	Clone gene from one organism into a fungal expression host (e.g., Pichia pastoris, Aspergillus oryzae)	Production of human serum albumin, insulin, hepatitis B vaccine (in S. cerevisiae or P. pastoris)
Promoter engineering	Use of strong, inducible promoters (e.g., AOX1 in P. pastoris; glaA in A. niger)	High-level expression of recombinant proteins
Protein engineering	Directed evolution, rational design to improve enzyme properties (thermostability, pH optimum, activity)	Tailor-made lipases, proteases for industrial conditions

5. Fungal Secondary Metabolites

5.1 Major Classes and Industrial Products

Class	Examples	Fungal Source	Activity / Use
Antibiotics	Penicillin	Penicillium chrysogenum	Antibacterial (cell wall synthesis inhibitor)
	Cephalosporin	Acremonium chrysogenum	Antibacterial (β-lactam, broader spectrum)
Statins (cholesterol-lowering)	Lovastatin (Mevacor®)	Aspergillus terreus	HMG-CoA reductase inhibitor; lowers LDL cholesterol
	Pravastatin (derived from compactin)	Penicillium citrinum	Same class (statin)
Immunosuppressants	Cyclosporine A	Tolypocladium inflatum	Transplant rejection (inhibits calcineurin in T-cells)
	Mycophenolic acid	Penicillium brevicompactum	Immunosuppressant (inhibits IMPDH)
Alkaloids	Ergot alkaloids (ergotamine)	Claviceps purpurea	Migraine treatment; uterine contraction
Mycotoxins (food contaminants)	Aflatoxin B₁	Aspergillus flavus, A. parasiticus	Carcinogenic; food safety concern (not a product, but a contamination issue)
	Ochratoxin A	Aspergillus ochraceus, Penicillium verrucosum	Nephrotoxic; contaminant in cereals, coffee, wine
Pigments	Monascus pigments (monascorubrin, ankaflavin)	Monascus purpureus	Natural food colorants (red yeast rice); also statin production
	Melanin (DHN-melanin)	Aspergillus niger, many others	Protection against UV and oxidative stress (potential bio-colorant)
Organic acids	Citric acid	Aspergillus niger	Food additive; acidulant; metal chelator
	Gluconic acid	Aspergillus niger	Food additive; chelator; cleaning agent
	Kojic acid	Aspergillus oryzae	Skin whitening; antioxidant; preservative

5.2 Production of Penicillin (Classic Example)

Strain: Penicillium chrysogenum (improved by classical mutagenesis: original strain produced 0.001 g/L; modern strains >50 g/L).
Fermentation: Submerged culture in stirred-tank bioreactor (fed-batch).
Medium: Corn steep liquor (C, N, growth factors), lactose (slowly used carbon source; represses catabolite repression), precursor (phenylacetic acid or phenoxyacetic acid incorporated into penicillin G or V).
Conditions: pH 6.5-7.0, temperature 25-28°C, high aeration.
Recovery: Filtration (remove biomass) → solvent extraction (butyl acetate) → crystallization → sterile filtration.

6. Fungal Biopesticides (Mycopesticides)

6.1 Major Entomopathogenic Fungi

Fungus	Target Pests	Mode of Action	Commercial Product
Beauveria bassiana	Aphids, whiteflies, thrips, beetles, grasshoppers, termites	Conidia adhere to cuticle → germinate → penetrate via enzymes (proteases, chitinases) → hyphae proliferate in hemocoel → produce toxins (beauvericin) → death	BotaniGard®, Mycotrol®
Metarhizium anisopliae	Locusts, beetles, spittlebugs, termites, ticks	Similar to Beauveria; produces destruxins (toxins)	Green Muscle® (locust control)
Lecanicillium lecanii	Aphids, whiteflies, thrips, mealybugs	Infects insect cuticle; also produces antibiotics	Vertalec®, Mycotal®
Hirsutella thompsonii	Mites (eriophyid mites)	Infects mites	Mycar® (discontinued)
Nomuraea rileyi	Lepidopteran larvae (soybean looper, velvetbean caterpillar)	Infects larval cuticle	Not widely commercialized; research

6.2 Advantages and Limitations of Mycopesticides

Advantages	Limitations
High specificity (non-toxic to beneficial insects, mammals, birds)	Slow kill (3-7 days; not suitable for immediate pest control)
Minimal environmental persistence (biodegradable)	Susceptible to UV light (must be applied in evening or with UV protectants)
Low risk of resistance development (multi-factorial mode of action)	Requires high humidity for spore germination (not effective in arid conditions)
Can be integrated with chemical pesticides (some synergy)	Limited shelf life (formulation dependent)
Produces persistent inoculum in soil (suppresses pest populations over time)	Higher cost than conventional chemical pesticides (often)

6.3 Formulation and Application

Propagation: Solid-state fermentation (SSF) on rice or grain (spore production).
Formulation types:
- Wettable powder (WP): Spores + carrier (talc, clay) + wetting agents.
- Oil dispersion (OD): Spores in oil (improves UV stability, adhesion).
- Granules: Spores coated on granular carrier (soil application for root pests).
- Liquid (aqueous): Spores suspended in water + surfactant.
Application: Foliar spray, soil drench, seed treatment, granular incorporation.

7. Mycoremediation (Fungal Bioremediation)

Fungi degrade a wide range of environmental pollutants through their extracellular enzyme systems, particularly lignin-modifying enzymes (LMEs).

7.1 Target Pollutants

Pollutant Class	Examples	Effective Fungi	Mechanism
Polycyclic aromatic hydrocarbons (PAHs)	Benzo[a]pyrene, naphthalene, anthracene	White-rot fungi (Phanerochaete chrysosporium, Pleurotus ostreatus)	Lignin peroxidase (LiP), manganese peroxidase (MnP), laccase → oxidation
Chlorinated compounds	PCBs, dioxins, chlorophenols, DDT	Phanerochaete, Trametes versicolor, Bjerkandera adusta	Ligninolytic enzymes; reductive dechlorination (some)
Synthetic dyes	Azo dyes, anthraquinone dyes, triphenylmethane dyes	Trametes, Phanerochaete, Aspergillus niger	Laccase, LiP, MnP (decolorization via oxidation)
Explosives	TNT (trinitrotoluene), RDX	Phanerochaete, Stropharia rugosoannulata	Nitroreductase; MnP; transformation to less toxic products
Pesticides	Atrazine, lindane, organophosphates	Phanerochaete, Pleurotus, Aspergillus	Cytochrome P450; hydrolases; LMEs
Heavy metals	Pb, Cd, Hg, Cr, As	Aspergillus, Penicillium, Rhizopus, Saccharomyces	Biosorption (cell wall binding); bioaccumulation; biotransformation (e.g., Cr(VI) → Cr(III))

7.2 Mechanisms of Fungal Bioremediation

Mechanism	Description	Examples
Biosorption	Passive binding of heavy metals to cell wall functional groups (carboxyl, hydroxyl, amino, phosphate)	Rhizopus arrhizus (lead, uranium); Aspergillus niger (cadmium)
Bioaccumulation	Active uptake and intracellular accumulation of metals/metalloids	Saccharomyces cerevisiae (copper, cadmium, chromium)
Biotransformation	Enzymatic conversion of pollutant to less toxic form (oxidation, reduction, methylation, demethylation)	Hg²⁺ → Hg⁰ (volatile, less toxic) by mercury reductase; Cr(VI) → Cr(III) (less soluble, less toxic)
Mineralization	Complete degradation of organic pollutant to CO₂, H₂O, inorganic ions	PAHs, TNT, DDT (by white-rot fungi, using LMEs)
Co-metabolism	Degradation of pollutant while growing on another primary substrate (often glucose or cellulose)	Many recalcitrant compounds require a co-substrate for induction of degradative enzymes

7.3 White-Rot Fungi as Bioremediation Agents

Key feature: Ability to degrade lignin (complex aromatic polymer in wood).
Lignin-modifying enzymes (LMEs):
- Lignin peroxidase (LiP): Oxidizes non-phenolic aromatic compounds; high redox potential.
- Manganese peroxidase (MnP): Requires Mn²⁺ as cofactor; produces Mn³⁺ (diffusible oxidant).
- Laccase (multicopper oxidase): Oxidizes phenolic compounds (and non-phenolic with mediators).
- Versatile peroxidase (VP): Combines properties of LiP and MnP (some fungi).
Advantages: Non-specific enzyme system allows degradation of a wide range of pollutants.
Limitations: Requires aerobic, low-shear conditions; may need co-substrate; slower than bacterial degradation.

8. Fungal Expression Systems (Recombinant Protein Production)

8.1 Yeast Expression Systems

System	Features	Glycosylation	Protein Yield	Applications
Saccharomyces cerevisiae	Well-characterized; easy genetic manipulation; GRAS (Generally Recognized As Safe)	High mannose type (hyperglycosylation; may be immunogenic)	Moderate (mg/L to low g/L)	Human serum albumin, hepatitis B surface antigen, insulin (early generation)
Pichia pastoris (Komagataella phaffii)	Strong inducible AOX1 promoter (methanol induction); high cell density; low secretion of endogenous proteins; methylotrophic	High mannose (but can be engineered to humanize)	High (g/L to >20 g/L)	Most widely used yeast for recombinant proteins (antibody fragments, enzymes, cytokines, vaccines)
Yarrowia lipolytica	Oleaginous (lipid production); strong promoters (TEF, hp4d)	High mannose (similar to Pichia)	High	Lipases; heterologous proteins; metabolic engineering for lipid-based chemicals
Kluyveromyces lactis	Lactic acid metabolism; strong LAC4 promoter (lactose induction)	High mannose	Moderate to high	Chymosin (rennet, for cheese making); other dairy-related enzymes

8.2 Filamentous Fungal Expression Systems

System	Features	Glycosylation	Applications
Aspergillus niger	GRAS; high protein secretion; strong glaA (glucoamylase) promoter; used for organic acid and enzyme production	High mannose (can be hyperglycosylated)	Native enzymes (glucoamylase, glucose oxidase, pectinase); heterologous proteins
Aspergillus oryzae	GRAS (used in traditional fermentation, soy sauce, sake); strong promoters (amyB, glaA)	High mannose	Native and heterologous proteins (enzymes for food, feed, brewing)
Trichoderma reesei	Industrial workhorse for cellulase production; strong cbh1 (cellobiohydrolase) promoter; high secretion capacity	High mannose	Recombinant enzymes (cellulases, hemicellulases, heterologous proteins under cbh1 promoter)
Penicillium chrysogenum	Used for penicillin production; but also an expression host (less common than Aspergillus)	High mannose	Penicillin pathway engineering; heterologous enzymes

8.3 Post-Translational Modifications in Fungi

Modification	Yeast	Filamentous Fungi	Mammals	Implications for Recombinant Protein Production
N-linked glycosylation	High mannose (Man₈-₁₄GlcNAc₂)	High mannose (Man₈-₁₄GlcNAc₂)	Complex (sialylated, fucosylated)	Non-mammalian glycosylation may cause immunogenicity or reduced serum half-life
O-linked glycosylation	Yes	Yes	Yes	May affect protein stability and activity
Disulfide bond formation	Yes (in ER)	Yes (in ER)	Yes (in ER)	Many heterologous proteins require correct disulfide bonding (fungi generally capable)
Proteolytic processing	Kex2, Ste13 (Kex2 in Pichia)	Similar to yeast; may produce heterogeneous products	Specific	May require engineering of protease-deficient strains

Strategy for humanized glycosylation:

Knockout native glycosylation genes (e.g., OCH1 in Pichia).
Express mammalian glycosyltransferases (e.g., GnT-I, GnT-II, GalT, SialT).
Result: Production of complex human-type glycoproteins (GlycoSwitch® technology; now used in Pichia for therapeutic protein production).

9. Fungal Fermented Foods

9.1 Traditional Fermented Foods

Product	Fungus	Substrate	Process	Key Changes
Sake (rice wine)	Aspergillus oryzae (koji) + Saccharomyces cerevisiae (yeast)	Polished rice	Koji making (A. oryzae converts starch to fermentable sugars) → moromi (yeast fermentation) → pressing, aging	Starch → sugars → ethanol; flavor compounds (esters, amino acids)
Soy sauce (shoyu)	Aspergillus oryzae or A. sojae + yeast and lactic acid bacteria (mixed fermentation)	Soybeans + wheat (1:1)	Koji (fungal fermentation, 3 days) → moromi (brine, 6-12 months)	Protein → amino acids (umami); starch → sugars → ethanol (0.5-2%); flavor development
Miso	Aspergillus oryzae + Saccharomyces cerevisiae + lactic acid bacteria	Soybeans + rice/barley (koji)	Koji making → fermentation (6-36 months)	Protein hydrolysis; umami; complex flavor
Tempeh	Rhizopus oligosporus (or R. oryzae)	Cooked, dehulled soybeans	Solid-state fermentation (24-48 hours, 30°C) → mycelium binds beans into cake	Protein digestibility improved; vitamin B₁₂ (some strains); nutty flavor
Ontjom	Neurospora intermedia (or Rhizopus)	Peanut press cake, coconut	Solid-state fermentation (2-3 days)	Protein enrichment; orange color (Neurospora conidia)
Blue cheese	Penicillium roqueforti	Curds (cow, sheep, goat milk)	Spores inoculated into curds; cheese ripened (2-6 months)	Lipolysis (methyl ketones, blue-green veins); proteolysis (texture, flavor)
Camembert cheese	Penicillium camemberti	Curds (cow milk)	White surface mold; ripening (3-6 weeks)	Proteolysis (soft, creamy texture); ammonia production (characteristic flavor)

9.2 Edible and Medicinal Mushrooms

Mushroom	Species	Cultivation Substrate	Bioactive Compounds	Uses
Button mushroom	Agaricus bisporus	Composted manure, straw	Ergosterol (vitamin D₂ precursor); polysaccharides	Table mushroom (most common)
Shiitake	Lentinula edodes	Sawdust, logs (oak)	Lentinan (β-glucan, antitumor); eritadenine (cholesterol-lowering)	Edible, medicinal (immune modulation)
Oyster mushroom	Pleurotus ostreatus	Straw, agricultural waste, coffee grounds	Pleuran (β-glucan); lovastatin (statin)	Edible; bioremediation (ligninolytic enzymes)
Reishi (Lingzhi)	Ganoderma lucidum	Sawdust, logs	Triterpenoids (ganoderic acids); polysaccharides (β-glucans)	Traditional medicine (immunomodulatory, antitumor, hepatoprotective)
Enoki (Enokitake)	Flammulina velutipes	Sawdust, waste paper	Flammulin (protein); polysaccharides	Edible (sprout-like form; commercial cultivation)
Cordyceps	Cordyceps militaris (cultivated); Ophiocordyceps sinensis (wild, rare)	Rice, insects (C. militaris on rice or pupae)	Cordycepin (3′-deoxyadenosine); adenosine analogs	Medicinal (energy, libido, respiratory function, immunomodulation)

10. Strain Improvement in Fungal Biotechnology

Method	Description	Examples
Classical mutagenesis and screening	Exposure to UV, chemical mutagens (NTG, EMS) → selection for desired phenotype (e.g., higher yield)	Penicillium chrysogenum (penicillin yield increased from 0.001 to >50 g/L); Aspergillus niger (citric acid yield)
Protoplast fusion	Fusion of protoplasts (cell wall removed) from related species or strains; allows recombination	Interspecific hybrids (e.g., Penicillium) for strain improvement
Parasexual recombination	Recombination in somatic (vegetative) cells of filamentous fungi without sexual cycle; occurs via heterokaryon formation and nuclear fusion	Strain improvement in Aspergillus nidulans, Penicillium (before genetic engineering)
Genetic engineering (recombinant DNA)	Transformation of fungi with foreign genes; gene knockout, overexpression, or editing (CRISPR/Cas9)	Pichia pastoris (heterologous protein production); Trichoderma (overexpression of cellulase genes); CRISPR for marker-free editing

11. Important Equations and Calculations

Topic	Equation	Units
Volumetric productivity (Qp)	$Q_{p} = t P ^{final} - P ^{initial}$	g/L·h
Specific productivity (qp)	$q_{p} = X Q ^{p} = X d P / d t$	g/g biomass·h
Yield coefficient (Yp/s)	$Y_{P / S} = Δ S Δ P$	g product / g substrate
Biomass yield (Yx/s)	$Y_{X / S} = Δ S Δ X$	g biomass / g substrate
Dilution rate (continuous culture)	$D = V F$	h⁻¹
Specific growth rate (μ)	$μ = t ^{2} - t ^{1} l n ( X ^{2} / X ^{1} )$ (exponential phase)	h⁻¹
Doubling time	$t_{d} = μ l n 2$	h

12. Key Terms and Definitions

Term	Definition
GRAS (Generally Recognized As Safe)	US FDA designation for organisms or products considered safe for food use (e.g., Saccharomyces cerevisiae, Aspergillus oryzae, A. niger).
GRAS for enzyme production means the organism does not produce harmful secondary metabolites under production conditions.
Mycelium	The vegetative, filamentous network of a fungus (hyphae).
Conidia (spores)	Asexual spores (typically haploid) for propagation and survival.
Sclerotium	Compact, hardened mass of mycelium (survival structure).
Fermentation (microbial)	Metabolic process producing chemical changes; in biotechnology, refers to microbial cultivation for product formation.
Submerged fermentation (SmF)	Cultivation in liquid medium.
Solid-state fermentation (SSF)	Cultivation on solid substrate with low moisture (no free-flowing water).
Biosorption	Passive binding of metal ions to microbial cell walls (dead or alive).
Bioaccumulation	Active uptake and intracellular concentration of metals (live cells).
Biomineralization	Formation of insoluble metal precipitates by microbial activity.
Mycorrhiza	Symbiotic association between fungi and plant roots (arbuscular, ectomycorrhizal). Improves nutrient (P, N) and water uptake.
Entomopathogenic fungus	Fungus that infects and kills insects.
Lignin-modifying enzymes (LMEs)	Extracellular enzymes (LiP, MnP, laccase, VP) that degrade lignin and structurally similar pollutants.
Heterologous expression	Expression of a gene from one organism in a different (host) organism.
Homologous expression	Expression of a gene in its native host (with strong promoters, gene amplification).
Catabolite repression	Inhibition of expression of certain genes (e.g., for secondary metabolism, alternative carbon source utilization) by a preferred carbon source (e.g., glucose).

13. Exam Tips

Mnemonics

White-rot enzymes (4): “Lions Manage Lions Violently” – LiP, MnP, Laccase, VP.
Fermentation Types (SmF vs. SSF): “SmF = Submerged (liquid); SSF = Solid (low moisture).”
Yeast Expression Systems (4 main): “Some People Know You” – S. cerevisiae, P. pastoris, K. lactis, Y. lipolytica.
Mycopesticides (4 major): “Be My Little Helper” – Beauveria, Metarhizium, Lecanicillium, Hirsutella.
Major fungal secondary metabolites: “Penicillin, Cephalosporin, Statins, Cyclosporine, Ergot alkaloids” – PCS CE.
Mushroom species (edible/medicinal): “All Smart People Love Reishi Cordyceps” – Agaricus, Shiitake, Pleurotus, Lentinula, Reishi, Cordyceps.

Common Pitfalls

Mistake	Correction
Confusing Trichoderma reesei (cellulase producer) with Trichoderma harzianum/viride (biocontrol agent)	T. reesei = enzymes (cellulase); T. harzianum = biocontrol (mycoparasite of fungal pathogens). Both belong to genus Trichoderma.
Believing all Aspergillus species are GRAS